Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Magnesium transporter protein 1 (MAGT1) Recombinant Protein | MAGT1 recombinant protein

Recombinant Human Magnesium transporter protein 1 (MAGT1)

Gene Names
MAGT1; IAP; XMEN; MRX95; OST3B; PRO0756; bA217H1.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Magnesium transporter protein 1 (MAGT1); Recombinant Human Magnesium transporter protein 1 (MAGT1); MAGT1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
30-335. Full Length of Mature Protein
Sequence
QRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MAGT1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,699 Da
NCBI Official Full Name
magnesium transporter protein 1
NCBI Official Synonym Full Names
magnesium transporter 1
NCBI Official Symbol
MAGT1
NCBI Official Synonym Symbols
IAP; XMEN; MRX95; OST3B; PRO0756; bA217H1.1
NCBI Protein Information
magnesium transporter protein 1
UniProt Protein Name
Magnesium transporter protein 1
UniProt Gene Name
MAGT1
UniProt Synonym Gene Names
IAG2; MagT1; IAP
UniProt Entry Name
MAGT1_HUMAN

NCBI Description

This gene encodes a magnesium cation transporter protein that localizes to the cell membrane. This protein also associates with N-oligosaccharyl transferase and therefore may have a role in N-glycosylation. Mutations in this gene cause mental retardation X-linked type 95 (MRX95). This gene may have multiple in-frame translation initiation sites, one of which would encode a shorter protein with an N-terminus containing a signal peptide at amino acids 1-29. [provided by RefSeq, Jan 2010]

Uniprot Description

MAGT1: May be involved in N-glycosylation through its association with N-oligosaccharyl transferase. May be involved in Mg(2+) transport in epithelial cells. Defects in MAGT1 are the cause of mental retardation X- linked type 95 (MRX95). Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific X-linked mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation. Defects in MAGT1 are the cause of immunodeficiency X- linked with magnesium defect Epstein-Barr virus infection and neoplasia (XMEN). XMEN is a disease characterized by CD4 lymphopenia, severe chronic viral infections, and defective T- lymphocyte activation. Belongs to the OST3/OST6 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: integral to plasma membrane; membrane; oligosaccharyl transferase complex; plasma membrane

Molecular Function: magnesium ion transmembrane transporter activity

Biological Process: cognition; magnesium ion transport; protein amino acid N-linked glycosylation; protein amino acid N-linked glycosylation via asparagine; transmembrane transport

Disease: Immunodeficiency, X-linked, With Magnesium Defect, Epstein-barr Virus Infection, And Neoplasia

Research Articles on MAGT1

Similar Products

Product Notes

The MAGT1 magt1 (Catalog #AAA7019766) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-335. Full Length of Mature Protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MAGT1 magt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QRKKEMVLSE KVSQLMEWTN KRPVIRMNGD KFRRLVKAPP RNYSVIVMFT ALQLHRQCVV CKQADEEFQI LANSWRYSSA FTNRIFFAMV DFDEGSDVFQ MLNMNSAPTF INFPAKGKPK RGDTYELQVR GFSAEQIARW IADRTDVNIR VIRPPNYAGP LMLGLLLAVI GGLVYLRRSN MEFLFNKTGW AFAALCFVLA MTSGQMWNHI RGPPYAHKNP HTGHVNYIHG SSQAQFVAET HIVLLFNGGV TLGMVLLCEA ATSDMDIGKR KIMCVAGIGL VVLFFSWMLS IFRSKYHGYP YSFLMS. It is sometimes possible for the material contained within the vial of "Magnesium transporter protein 1 (MAGT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.