Protein mago nashi (mago) Recombinant Protein | mago recombinant protein
Recombinant Drosophila melanogaster Protein mago nashi (mago)
Gene Names
mago; CG9401; Dm MGN; DmelCG9401; DmMago; l(2)57Ca; Mago; Magoh; MAGOH; mgn; MGN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein mago nashi (mago); Recombinant Drosophila melanogaster Protein mago nashi (mago); mago recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-147, Full length protein
Sequence
MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI
Sequence Length
147
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,311 Da
NCBI Official Full Name
mago nashi
NCBI Official Synonym Full Names
mago nashi
NCBI Official Symbol
mago
NCBI Official Synonym Symbols
CG9401; Dm MGN; DmelCG9401; DmMago; l(2)57Ca; Mago; Magoh; MAGOH; mgn; MGN
NCBI Protein Information
CG9401 gene product from transcript CG9401-RA
UniProt Protein Name
Protein mago nashi
Protein Family
UniProt Gene Name
mago
Uniprot Description
Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs (PubMed:14973490, PubMed:24967911). Involved in exon definition of genes containing long introns, including the rolled/MAPK gene (PubMed:20946982, PubMed:20946983). The mago-tsu heterodimer interacts with the EJC key regulator Pym leading to EJC disassembly in the cytoplasm (PubMed:24967911). Has a role in oskar mRNA localization to the posterior pole of the developing oocyte, and may also be involved in polarization of the oocyte microtubule cytoskeleton (PubMed:8026338, PubMed:9272960).
Research Articles on mago
Similar Products
Product Notes
The mago mago (Catalog #AAA1118901) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-147, Full length protein. The amino acid sequence is listed below: MSTEDFYLRY YVGHKGKFGH EFLEFEFRPD GKLRYANNSN YKNDTMIRKE AFVHQSVMEE LKRIIIDSEI MQEDDLPWPP PDRVGRQELE IVIGDEHISF TTSKTGSLVD VNRSKDPEGL RCFYYLVQDL KCLVFSLIGL HFKIKPI. It is sometimes possible for the material contained within the vial of "Protein mago nashi (mago), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
