Mitotic spindle assembly checkpoint protein MAD2B (mad2l2) Recombinant Protein | mad2l2 recombinant protein
Recombinant Danio rerio Mitotic spindle assembly checkpoint protein MAD2B (mad2l2)
Gene Names
si:dkey-23c22.2; mad2l2; zgc:110299
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitotic spindle assembly checkpoint protein MAD2B (mad2l2); Recombinant Danio rerio Mitotic spindle assembly checkpoint protein MAD2B (mad2l2); mad2l2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-211, Full length protein
Sequence
MATLTRQDLNFGQVVADILCEFLEVAIHLILYVRDIYPSGIFQKRQKYNVPVQMSCHPQLNQYIQDTLHCVKPLIEKNEAEKVVVVIMNKEHHPVERFVFEISQPPLLAISSETLLSHVEQLLRAMILKISVCDAVLDSNPPGCTFTVLVHTREAATRNMEKVQVIKDFPWIVADEQEVHMEEAKLIPLKTMTSDILKMQLYVEEKTQKSS
Sequence Length
211
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,224 Da
NCBI Official Full Name
mitotic spindle assembly checkpoint protein MAD2B
NCBI Official Synonym Full Names
si:dkey-23c22.2
NCBI Official Symbol
si:dkey-23c22.2
NCBI Official Synonym Symbols
mad2l2; zgc:110299
NCBI Protein Information
mitotic spindle assembly checkpoint protein MAD2B
UniProt Protein Name
Mitotic spindle assembly checkpoint protein MAD2B
Protein Family
UniProt Gene Name
mad2l2
UniProt Synonym Gene Names
MAD2-like protein 2
Uniprot Description
Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit rev3l and the inserter polymerase rev1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. May also play a role in signal transduction in response to DNA damage. May regulate the activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Through transcriptional regulation may play a role in epithelial-mesenchymal transdifferentiation ().
Similar Products
Product Notes
The mad2l2 mad2l2 (Catalog #AAA1431699) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-211, Full length protein. The amino acid sequence is listed below: MATLTRQDLN FGQVVADILC EFLEVAIHLI LYVRDIYPSG IFQKRQKYNV PVQMSCHPQL NQYIQDTLHC VKPLIEKNEA EKVVVVIMNK EHHPVERFVF EISQPPLLAI SSETLLSHVE QLLRAMILKI SVCDAVLDSN PPGCTFTVLV HTREAATRNM EKVQVIKDFP WIVADEQEVH MEEAKLIPLK TMTSDILKMQ LYVEEKTQKS S. It is sometimes possible for the material contained within the vial of "Mitotic spindle assembly checkpoint protein MAD2B (mad2l2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
