Probable macrolide-specific efflux protein macA (macA) Recombinant Protein | macA recombinant protein

Recombinant Yersinia pestis Probable macrolide-specific efflux protein macA (macA)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Probable macrolide-specific efflux protein macA (macA); Recombinant Yersinia pestis Probable macrolide-specific efflux protein macA (macA); macA recombinant protein

Ordering
Cat. Num. AAA1248230 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

27-371, Full length

Sequence

RHLMAPVPVNYQTVKVVHRDLQQNVLATGKLDAVRKVDVGAQVSGQLEKLYVEIGDHVKRGQLLAMIDPQQAQNQIKEVEATLQDLNAQRIQAKAELHLATVTLGRQQNLAKLQVVSRQDLDQAVTDLAVKNAKVGTIDAQINKAKASLDTAKINLDYTQISAPMDGDVVQITTLQGQTVIAAQQAPNILTLADMSTMLVQAQVSEADVINLKPGMKASFTVLGDPGKRFSGVLKDILPTPEKVNDAIFYSARFEVPNPDRLLRLQMTAQVSIQLANVDQAVVIPLAALGDELGSNRYQVTVLKEGKEEKREVTIGIRNNVDAQVISGLSVGEDVIVSRGGTGDA

Sequence Length

345

Species

Yersinia pestis

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

488140144

NCBI Accession #

WP_002211352.1

NCBI GenBank Nucleotide #

WP_002211352.1

UniProt Accession #

P58411; Q0WH51

Molecular Weight

40,186 Da

NCBI Official Full Name

MULTISPECIES: macrolide export protein MacA

UniProt Protein Name

Macrolide export protein MacA

Protein Family

Maleylacetate reductase

UniProt Gene Name

macA

Uniprot Description

Part of the tripartite efflux system MacAB-TolC. MacA stimulates the ATPase activity of MacB by promoting the closed ATP-bound state of MacB, increases the capacity of MacB to bind macrolides such as erythromycin, and provides a physical link between MacB and TolC. Confers resistance against macrolides ().

Similar Products

Product Notes

The macA maca (Catalog #AAA1248230) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-371, Full length. The amino acid sequence is listed below: RHLMAPVPVN YQTVKVVHRD LQQNVLATGK LDAVRKVDVG AQVSGQLEKL YVEIGDHVKR GQLLAMIDPQ QAQNQIKEVE ATLQDLNAQR IQAKAELHLA TVTLGRQQNL AKLQVVSRQD LDQAVTDLAV KNAKVGTIDA QINKAKASLD TAKINLDYTQ ISAPMDGDVV QITTLQGQTV IAAQQAPNIL TLADMSTMLV QAQVSEADVI NLKPGMKASF TVLGDPGKRF SGVLKDILPT PEKVNDAIFY SARFEVPNPD RLLRLQMTAQ VSIQLANVDQ AVVIPLAALG DELGSNRYQV TVLKEGKEEK REVTIGIRNN VDAQVISGLS VGEDVIVSRG GTGDA. It is sometimes possible for the material contained within the vial of "Probable macrolide-specific efflux protein macA (macA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...