Matrix protein 2 (M) Recombinant Protein | M recombinant protein

Recombinant Influenza A virus Matrix protein 2 (M)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Matrix protein 2 (M); Recombinant Influenza A virus Matrix protein 2 (M); Recombinant Matrix protein 2 (M); Matrix protein 2; Proton channel protein M2; M recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-97
• Sequence: MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE
• Sequence Length: 97

• Species: Influenza A virus (strain A/Hong Kong/156/1997 H5N1 genotype Gs/Gd)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 54036546
• UniProt Accession #: O70632; Q77XR7
• Molecular Weight: 11,177 Da
• NCBI Official Full Name: Matrix protein 2
• UniProt Protein Name: Matrix protein 2
• UniProt Gene Name: M
• UniProt Entry Name: M2_I97A1

Uniprot Description

Function: Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation.

Enzyme regulation: The M2 protein from most influenza A strains is inhibited by amantadine and rimantadine, resulting in viral uncoating incapacity. Emergence of amantadine-resistant variants is usually rapid.

Subunit structure: Homotetramer; composed of two disulfide-linked dimers held together by non-covalent interactions. May interact with matrix protein 1

By similarity.

Subcellular location: Virion membrane

By similarity. Host apical cell membrane; Single-pass type III membrane protein

By similarity. Note: Abundantly expressed at the apical plasma membrane in infected polarized epithelial cells, in close proximity to budding and assembled virions. Minor component of virions (only 16-20 molecules/virion)

By similarity.

Domain: Cytoplasmic tail plays an important role in virion assembly and morphogenesis

By similarity.

Miscellaneous: When the channel is activated, imidazole moities of His-37 probably become bi-protonated.

Sequence similarities: Belongs to the influenza viruses matrix protein M2 family.