Lysine--tRNA ligase (lysS) Recombinant Protein | lysS recombinant protein
Recombinant Shewanella baltica Lysine--tRNA ligase (lysS)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysine--tRNA ligase (lysS); Recombinant Shewanella baltica Lysine--tRNA ligase (lysS); Recombinant Lysine--tRNA ligase (lysS); Lysine--tRNA ligase EC= 6.1.1.6; Lysyl-tRNA synthetase; LysRS; lysS recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-500aa; full length protein
Sequence
MTEQVIDENKLIAERRAKLESIRPNCSANAHPNTFRRTHKAAELQAQYGQNTKEELEALG FKTSIAGRIMAKRGPFLVIQDVSGRIQAYAEKSVQADLKERFQGLDIGDIIGVTGQLHLS GKGDLYVNMEQYELLTKALRPLPADYYGLADQEMRYRQRYVDLIVNEDSRNAFIMRSKVV SAIRNFMIKKEFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGG FERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEMLSSIAIELLGSAQM PYGEHTVDFGGPYARLSMLEAIQKYNPDNATIQAMTYEQVKDVEFMRDLAKSLGMKIEKF WTCGQLLEEIFGETAEWQLMQPTFITGYPADISPLARRNDDNHFITDRFEFFIGGREVAN GFSELNDAEDQDNRFKAQVDAKDAGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVML FTNTHTIRDVILFPAMRPQA
Sequence Length
500
Species
Shewanella baltica (strain OS195)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,025 Da
NCBI Official Full Name
lysyl-tRNA synthetase
NCBI Official Symbol
lysS
NCBI Protein Information
lysyl-tRNA synthetase
UniProt Protein Name
Lysine--tRNA ligase
Protein Family
UniProt Gene Name
lysS
UniProt Synonym Gene Names
LysRS
UniProt Entry Name
SYK_SHEB9
Uniprot Description
Catalytic activity: ATP + L-lysine + tRNA(Lys) = AMP + diphosphate + L-lysyl-tRNA(Lys). HAMAP-Rule MF_00252
Cofactor: Binds 3 magnesium ions per subunit
By similarity. HAMAP-Rule MF_00252
Subunit structure: Homodimer
By similarity. HAMAP-Rule MF_00252
Subcellular location: Cytoplasm
By similarity HAMAP-Rule MF_00252.
Sequence similarities: Belongs to the class-II aminoacyl-tRNA synthetase family.
Similar Products
Product Notes
The lysS lyss (Catalog #AAA1201005) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-500aa; full length protein. The amino acid sequence is listed below: MTEQVIDENK LIAERRAKLE SIRPNCSANA HPNTFRRTHK AAELQAQYGQ NTKEELEALG FKTSIAGRIM AKRGPFLVIQ DVSGRIQAYA EKSVQADLKE RFQGLDIGDI IGVTGQLHLS GKGDLYVNME QYELLTKALR PLPADYYGLA DQEMRYRQRY VDLIVNEDSR NAFIMRSKVV SAIRNFMIKK EFMEVETPMM HVIPGGASAR PFITHHNALD MPMYLRIAPE LYLKRLVVGG FERVFEINRN FRNEGLSPRH NPEFTMMEFY MAYADYKDLM DLTEEMLSSI AIELLGSAQM PYGEHTVDFG GPYARLSMLE AIQKYNPDNA TIQAMTYEQV KDVEFMRDLA KSLGMKIEKF WTCGQLLEEI FGETAEWQLM QPTFITGYPA DISPLARRND DNHFITDRFE FFIGGREVAN GFSELNDAED QDNRFKAQVD AKDAGDDEAM FYDADYITAL EHGLPPTAGQ GIGIDRLVML FTNTHTIRDV ILFPAMRPQA. It is sometimes possible for the material contained within the vial of "Lysine--tRNA ligase (lysS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
