Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

(Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1) Recombinant Protein | LYNX1 recombinant protein

Recombinant Macaca mulatta (Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1); Recombinant Macaca mulatta (Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1); Recombinant (Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1); Ly-6/neurotoxin-like protein 1; LYNX1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-95
Sequence
LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKVSKSCVPSCFETVYDGYSKHASTTSCCQYDLCNS
Sequence Length
131
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,090 Da
NCBI Official Full Name
ly-6/neurotoxin-like protein 1
NCBI Official Symbol
LYNX1
NCBI Protein Information
ly-6/neurotoxin-like protein 1; Ly-6 neurotoxin-like protein 1
UniProt Protein Name
Ly-6/neurotoxin-like protein 1
UniProt Gene Name
LYNX1
UniProt Entry Name
LYNX1_MACMU

Uniprot Description

Function: Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). Isoforms 2/4 modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs

By similarity. Prevents plasticity in the primary visual cortex late in life

By similarity. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis

By similarity.

Subunit structure: Interacts with nAChRs, including alpha4beta2 (CHRNA4/CHRNB2) and alpha7 (CHRNA7)

By similarity.

Subcellular location: Isoform 1: Secreted

Potential Ref.1. Isoform 2: Cell membrane; Lipid-anchor › GPI-anchor

Potential Ref.1. Cell projection › dendrite

By similarity. Note: Detected in Purkinje cells soma and proximal dendrites

By similarity. Colocalizes with different types of nAChRs. Ref.1Isoform 3: Secreted

By similarity Ref.1. Isoform 4: Cell membrane; Lipid-anchor › GPI-anchor

Potential Ref.1.

Tissue specificity: Expressed in brain. Isoforms 2/4 expressed in lung. In the lung, expressed predominantly in airway epithelial cells, submucous glands, and smooth muscle cells, in endothelial and smooth muscle cells in vessel walls and in alveolar type II cells (at protein level). Ref.1

Developmental stage: Detected as early as day 71 of gestation. Expression increases consistently in lungs throughout the prenatal period. After birth, expression continues well into adulthood. At 71 days of gestation (pseudoglandular phase), expression is detected in tracheal and proximal conducting airway epithelium. Expression decreases gradually toward the distal airways. Strong expression in the epithelium lining the tips of the dichotomous and monopodial airway buds. Weakly expressed in smooth muscle cells around the large airways. Weakly expressed in mesenchymal cells and not at all in the mesenchymal cells surrounding the airway buds. Not detected in vessels associated with large airways (at protein level). At 94 days of gestation, similar expression pattern, but expression increases and extends toward distal airway epithelium. Strong expression in type II cells that line the primitive air spaces of late canalicular and early saccular phase. More prominent expression in the smooth muscle cells surrounding the large airways. Begins to be weakly expressed in endothelial and smooth muscle cells in large vessels, but not in small distal vessels (at protein level). At day 134 of gestation, further increase in expression in the distal airway epithelium. In large airways, predominantly expressed in the ciliated epithelium. Expressed at low levels in the mucus-secreting cells and at high levels in the submucosal gland cells. Weakly expressed in paracartilaginous cells, but not in cells in the extra-cartilaginous layer. Not detected in type I alveolar cells. Strongly expressed in endothelial and smooth muscle cells increased in large vessels and in distal vessels (at protein level). At birth, similar pattern of expression. Slightly decreased expression in the proximal airways (at protein level). Ref.1

Induction: Up-regulated by prenatal nicotine exposure. Ref.1

Sequence similarities: Contains 1 UPAR/Ly6 domain.

Research Articles on LYNX1

Similar Products

Product Notes

The LYNX1 lynx1 (Catalog #AAA950651) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-95. The amino acid sequence is listed below: LDCHVCAYNG DNCFNPMRCP AMVAYCMTTR TYYTPTRMKV SKSCVPSCFE TVYDGYSKHA STTSCCQYDL CNS. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.