Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ly-6/neurotoxin-like protein 1 (LYNX1) Recombinant Protein | LYNX1 recombinant protein

Recombinant Saimiri boliviensis boliviensis Ly-6/neurotoxin-like protein 1 (LYNX1)

Gene Names
LOC101034926; LYNX1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ly-6/neurotoxin-like protein 1 (LYNX1); Recombinant Saimiri boliviensis boliviensis Ly-6/neurotoxin-like protein 1 (LYNX1); LYNX1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-93, Full length protein
Sequence
LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKVSKSCVPSCFETVYDGYSKHASTTSCCQYDLCNG
Sequence Length
73
Species
Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,534 Da
NCBI Official Full Name
ly-6/neurotoxin-like protein 1-like
NCBI Official Symbol
LOC101034926
NCBI Official Synonym Symbols
LYNX1
NCBI Protein Information
ly-6/neurotoxin-like protein 1-like
UniProt Protein Name
Ly-6/neurotoxin-like protein 1
UniProt Gene Name
LYNX1

Uniprot Description

Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). The proposed role as modulator of nAChR activity seems to be dependent on the nAChR subtype and stoichiometry, and to involve an effect on nAChR trafficking and its cell surface expression, and on single channel properties of the nAChR inserted in the plasma membrane.Modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha-4:beta-2-containing nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha-4:beta-2 nAChRs. Is involved in regulation of the nAChR pentameric assembly in the endoplasmic reticulum. Shifts stoichiometry from high sensitivity alpha-42:beta-23 to low sensitivity alpha-43:beta-22 nAChR. In vitro modulates alpha-3:beta-4-containing nAChRs. Reduces cell surface expression of (alpha-3:beta-4)2:beta-4 and (alpha-3:beta-4)2:alpha-5 nAChRs suggesting an interaction with nAChR alpha-3-:+beta-4 subunit interfaces and an allosteric mode. Corresponding single channel effects characterized by decreased unitary conductance, altered burst proportions and enhanced desensitization/inactivation seem to depend on nAChR alpha:alpha subunit interfaces and are greater in (alpha-3:beta-2)2:alpha-3 when compared to (alpha-3:beta-2)2:alpha-5 nAChRs. Prevents plasticity in the primary visual cortex late in life.

Similar Products

Product Notes

The LYNX1 lynx1 (Catalog #AAA1299066) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-93, Full length protein. The amino acid sequence is listed below: LDCHVCAYNG DNCFNPMRCP AMVAYCMTTR TYYTPTRMKV SKSCVPSCFE TVYDGYSKHA STTSCCQYDL CNG. It is sometimes possible for the material contained within the vial of "Ly-6/neurotoxin-like protein 1 (LYNX1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.