LysM domain-containing GPI-anchored protein 2 (At2g17120) Recombinant Protein | At2g17120 recombinant protein
Recombinant Arabidopsis thaliana LysM domain-containing GPI-anchored protein 2 (At2g17120)
Gene Names
LYM2; CEBiP-like 1; CL-1; F6P23.25; F6P23_25; LYP1; lysm domain GPI-anchored protein 2 precursor; lysM domain GPI-anchored protein 2 precursor; LysM-containing receptor protein 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
LysM domain-containing GPI-anchored protein 2 (At2g17120); Recombinant Arabidopsis thaliana LysM domain-containing GPI-anchored protein 2 (At2g17120); At2g17120 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-327, Full length protein
Sequence
QMTGNFNCSGSTSTCQSLVGYSSKNATTLRNIQTLFAVKNLRSILGANNLPLNTSRDQRVNPNQVVRVPIHCSCSNGTGVSNRDIEYTIKKDDILSFVATEIFGGLVTYEKISEVNKIPDPNKIEIGQKFWIPLPCSCDKLNGEDVVHYAHVVKLGSSLGEIAAQFGTDNTTLAQLNGIIGDSQLLADKPLDVPLKACSSSVRKDSLDAPLLLSNNSYVFTANNCVKCTCDALKNWTLSCQSSSEIKPSNWQTCPPFSQCDGALLNASCRQPRDCVYAGYSNQTIFTTASPACPDSAGPDNYAS
Sequence Length
304
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,739 Da
NCBI Official Full Name
lysm domain GPI-anchored protein 2
NCBI Official Symbol
LYM2
NCBI Official Synonym Symbols
CEBiP-like 1; CL-1; F6P23.25; F6P23_25; LYP1; lysm domain GPI-anchored protein 2 precursor; lysM domain GPI-anchored protein 2 precursor; LysM-containing receptor protein 1
NCBI Protein Information
lysm domain GPI-anchored protein 2 precursor
UniProt Protein Name
LysM domain-containing GPI-anchored protein 2
UniProt Gene Name
LYM2
UniProt Synonym Gene Names
CEBiP LYM2
NCBI Description
Induction of chitin-responsive genes by chitin treatment is not blocked in the mutant.
Uniprot Description
Chitin elicitor-binding protein involved in the perception of chitin oligosaccharide elicitor.
Research Articles on At2g17120
Similar Products
Product Notes
The At2g17120 lym2 (Catalog #AAA1020404) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-327, Full length protein. The amino acid sequence is listed below: QMTGNFNCSG STSTCQSLVG YSSKNATTLR NIQTLFAVKN LRSILGANNL PLNTSRDQRV NPNQVVRVPI HCSCSNGTGV SNRDIEYTIK KDDILSFVAT EIFGGLVTYE KISEVNKIPD PNKIEIGQKF WIPLPCSCDK LNGEDVVHYA HVVKLGSSLG EIAAQFGTDN TTLAQLNGII GDSQLLADKP LDVPLKACSS SVRKDSLDAP LLLSNNSYVF TANNCVKCTC DALKNWTLSC QSSSEIKPSN WQTCPPFSQC DGALLNASCR QPRDCVYAGY SNQTIFTTAS PACPDSAGPD NYAS. It is sometimes possible for the material contained within the vial of "LysM domain-containing GPI-anchored protein 2 (At2g17120), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
