WD repeat-containing protein LWD2 (LWD2) Recombinant Protein | LWD2 recombinant protein
Recombinant Arabidopsis thaliana WD repeat-containing protein LWD2 (LWD2)
Gene Names
LWD2; LIGHT-REGULATED WD 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WD repeat-containing protein LWD2 (LWD2); Recombinant Arabidopsis thaliana WD repeat-containing protein LWD2 (LWD2); LWD2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-346, Full length protein
Sequence
MVTSSDQIQNGSEEQSKRSEIYTYEAPWQIYAMNWSIRRDKKYRLAITSLIEQYPNRVEIVQLDESNGEIRSDPNLCFEHPYPPTKTSFIPDKECQRPDLLATSSDFLRLWRISDDESRVELKSCLSSDKNSEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWDIEREVVDTQLIAHDKEVYDIAWGGVGVFASVSEDGSVRVFDLRDKEHSTIIYESGEPSTPLVRLSWNKQDPRYMATVIMGSAKIVVLDIRFPALPVVELQRHQASVNAIAWAPHSSSHICSAGDDSQALIWDISSMGQHVEGGLDPILAYTAGAEVEQLQWSSSQPDWVAIAFSNKLQILRV
Sequence Length
346
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,092 Da
NCBI Official Full Name
Transducin/WD40 repeat-like superfamily protein
NCBI Official Symbol
LWD2
NCBI Official Synonym Symbols
LIGHT-REGULATED WD 2
NCBI Protein Information
Transducin/WD40 repeat-like superfamily protein
UniProt Protein Name
WD repeat-containing protein LWD2
Protein Family
UniProt Gene Name
LWD2
UniProt Synonym Gene Names
AN11B; AtAN11-B
NCBI Description
Encodes LIGHT-REGULATED WD1 (LWD1), a clock proteins regulating circadian period length and photoperiodic flowering.
Uniprot Description
Clock protein essential for the proper expression phase and period length of both the oscillator and output genes known to participate in photoperiod sensing. Required for the expression of APRR9, APRR7, and APRR5. Regulated by APRR9 and APRR7 at the transcriptional level, indicating the existence of a positive feedback loop within the circadian clock (PubMed:21357491).
Research Articles on LWD2
Similar Products
Product Notes
The LWD2 lwd2 (Catalog #AAA1390738) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-346, Full length protein. The amino acid sequence is listed below: MVTSSDQIQN GSEEQSKRSE IYTYEAPWQI YAMNWSIRRD KKYRLAITSL IEQYPNRVEI VQLDESNGEI RSDPNLCFEH PYPPTKTSFI PDKECQRPDL LATSSDFLRL WRISDDESRV ELKSCLSSDK NSEFSGPITS FDWNEAEPRR IGTSSIDTTC TIWDIEREVV DTQLIAHDKE VYDIAWGGVG VFASVSEDGS VRVFDLRDKE HSTIIYESGE PSTPLVRLSW NKQDPRYMAT VIMGSAKIVV LDIRFPALPV VELQRHQASV NAIAWAPHSS SHICSAGDDS QALIWDISSM GQHVEGGLDP ILAYTAGAEV EQLQWSSSQP DWVAIAFSNK LQILRV. It is sometimes possible for the material contained within the vial of "WD repeat-containing protein LWD2 (LWD2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
