Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Lumican/LUM Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)

Lumican/LUM Recombinant Protein | LUM recombinant protein

Recombinant Human Lumican/LUM Protein

Gene Names
LUM; LDC; SLRR2D
Purity
>95% by SDS-PAGE.
Synonyms
Lumican/LUM; Recombinant Human Lumican/LUM Protein; LDC; SLRR2D; LUM recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Sequence Length
338
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Lumican/LUM Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)

SDS-Page (Recombinant Human Lumican/LUM Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)
Related Product Information for LUM recombinant protein
Description: Recombinant Human Lumican/LUM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Asn338) of human Lumican/LUM (Accession #NP_002336.1) fused with a 6xHis tag at the C-terminus.

Background: Lumican is a member of the family of small leucine-rich repeat proteoglycans (SLRPs) and the class II subfamily.which is a major component of the cornea, dermal, and muscle connective tissues. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and is also present in the connective tissues of other organs and embryonic corneal stroma as a glycoprotein. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. Lumican’s over-expression has been reported in carcinoid tumor, breast, colorectal, neuroendocrine, uterine cervical and pancreatic cancers
Product Categories/Family for LUM recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
lumican
NCBI Official Synonym Full Names
lumican
NCBI Official Symbol
LUM
NCBI Official Synonym Symbols
LDC; SLRR2D
NCBI Protein Information
lumican
UniProt Protein Name
Lumican
Protein Family
UniProt Gene Name
LUM
UniProt Synonym Gene Names
LDC; SLRR2D; KSPG lumican
UniProt Entry Name
LUM_HUMAN

NCBI Description

This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008]

Uniprot Description

LUM: a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008]

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12q21.33

Cellular Component: extracellular matrix; extracellular space; lysosomal lumen; proteinaceous extracellular matrix; fibrillar collagen; Golgi lumen; extracellular region

Molecular Function: collagen binding; protein binding; extracellular matrix structural constituent

Biological Process: keratan sulfate metabolic process; extracellular matrix organization and biogenesis; collagen fibril organization; glycosaminoglycan metabolic process; visual perception; cartilage development; keratan sulfate biosynthetic process; carbohydrate metabolic process; positive regulation of transcription from RNA polymerase II promoter; pathogenesis; keratan sulfate catabolic process; response to organic cyclic substance

Research Articles on LUM

Similar Products

Product Notes

The LUM lum (Catalog #AAA9141783) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QYYDYDFPLS IYGQSSPNCA PECNCPESYP SAMYCDELKL KSVPMVPPGI KYLYLRNNQI DHIDEKAFEN VTDLQWLILD HNLLENSKIK GRVFSKLKQL KKLHINHNNL TESVGPLPKS LEDLQLTHNK ITKLGSFEGL VNLTFIHLQH NRLKEDAVSA AFKGLKSLEY LDLSFNQIAR LPSGLPVSLL TLYLDNNKIS NIPDEYFKRF NALQYLRLSH NELADSGIPG NSFNVSSLVE LDLSYNKLKN IPTVNENLEN YYLEVNQLEK FDIKSFCKIL GPLSYSKIKH LRLDGNRISE TSLPPDMYEC LRVANEVTLN. It is sometimes possible for the material contained within the vial of "Lumican/LUM, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.