Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Lumican Recombinant Protein | Lum recombinant protein

Recombinant Rat Lumican

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lumican; Recombinant Rat Lumican; Keratan sulfate proteoglycan lumican; KSPG lumican; Lum recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-338aa; Full Length
Sequence
QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
Sequence Length
338
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for Lum recombinant protein
References
"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues." Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876(2012)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40.5 kDa
NCBI Official Full Name
lumican
NCBI Official Synonym Full Names
lumican
NCBI Official Symbol
Lum
NCBI Protein Information
lumican
UniProt Protein Name
Lumican
Protein Family
UniProt Gene Name
Lum
UniProt Synonym Gene Names
Lcn; Ldc; KSPG lumican
UniProt Entry Name
LUM_RAT

NCBI Description

member of leucine-rich proteoglycan family; may play a role in immature and transient fibrosis of acute pancreatitis [RGD, Feb 2006]

Uniprot Description

LUM: a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008]

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular matrix; extracellular space; fibrillar collagen; proteinaceous extracellular matrix

Molecular Function: collagen binding

Biological Process: axonogenesis; cartilage development; collagen fibril organization; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transforming growth factor-beta1 production; response to organic cyclic substance; visual perception

Research Articles on Lum

Similar Products

Product Notes

The Lum lum (Catalog #AAA1072244) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-338aa; Full Length. The amino acid sequence is listed below: QYYDYDAPLF MYGELSPNCA PECNCPHSYP TAMYCDDLKL KSVPMVPPGI KYLYLRNNQI DHIDEKAFEN VTDLQWLILD HNLLENSKIK GKVFSKLKQL KKLHINYNNL TESVGPLPKS LQDLQLANNK ISKLGSFDGL VNLTFIYLQH NQLKEEAVSA SLKGLKSLEY LDLSFNQMSK LPAGLPTSLL TLYLDNNKIT NIPDEYFNRF TGLQYLRLSH NELADSGVPG NSFNISSLLE LDLSYNKLKS IPTVNENLEN YYLEVNKLEK FDVKSFCKIL GPLSYSKIKH LRLDGNPLTQ SSLPPDMYEC LRVANEITVN. It is sometimes possible for the material contained within the vial of "Lumican, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.