Lipoprotein signal peptidase (lspA) Recombinant Protein | lspA recombinant protein
Recombinant Bartonella tribocorum Lipoprotein signal peptidase (lspA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipoprotein signal peptidase (lspA); Recombinant Bartonella tribocorum Lipoprotein signal peptidase (lspA); Recombinant Lipoprotein signal peptidase (lspA); Lipoprotein signal peptidase EC= 3.4.23.36; Prolipoprotein signal peptidase Signal peptidase II; SPase II; lspA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-167
Sequence
MIRKSLLFLLLGLTLTAGLDQAVKYWVMQNMPLGTEIPLIPFLSLYHVRNSGIAFSFFSSFSHWGIIAITIIVIIFLLWLWKNTEDNKFLMRFGLVLIIGGAIGNLIDRIRFHHVTDYILFYIDDIFYFAIFNLADSFITLGVIVILIEELRTWMKAKRDSNHTSSH
Sequence Length
167
Species
Bartonella tribocorum (strain CIP 105476 / IBS 506)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,329 Da
NCBI Official Full Name
lipoprotein signal peptidase
NCBI Official Symbol
lspA
NCBI Protein Information
lspA; lipoprotein signal peptidase
UniProt Protein Name
Lipoprotein signal peptidase
Protein Family
UniProt Gene Name
lspA
UniProt Synonym Gene Names
SPase II
UniProt Entry Name
LSPA_BART1
Uniprot Description
Function: This protein specifically catalyzes the removal of signal peptides from prolipoproteins
By similarity. HAMAP-Rule MF_00161
Catalytic activity: Release of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains. HAMAP-Rule MF_00161
Pathway: Protein modification; lipoprotein biosynthesis (signal peptide cleavage). HAMAP-Rule MF_00161
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_00161.
Sequence similarities: Belongs to the peptidase A8 family.
Similar Products
Product Notes
The lspA lspa (Catalog #AAA1143678) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-167. The amino acid sequence is listed below: MIRKSLLFLL LGLTLTAGLD QAVKYWVMQN MPLGTEIPLI PFLSLYHVRN SGIAFSFFSS FSHWGIIAIT IIVIIFLLWL WKNTEDNKFL MRFGLVLIIG GAIGNLIDRI RFHHVTDYIL FYIDDIFYFA IFNLADSFIT LGVIVILIEE LRTWMKAKRD SNHTSSH. It is sometimes possible for the material contained within the vial of "Lipoprotein signal peptidase (lspA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
