Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Low-density lipoprotein receptor-related protein 2 (LRP2) Recombinant Protein | LRP2 recombinant protein

Recombinant Human Low-density lipoprotein receptor-related protein 2 (LRP2) , partial

Gene Names
LRP2; DBS; GP330
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Low-density lipoprotein receptor-related protein 2 (LRP2); Recombinant Human Low-density lipoprotein receptor-related protein 2 (LRP2); partial; LRP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1186-1389aa; Partial
Sequence
NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page
Product Categories/Family for LRP2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.2 kDa
NCBI Official Full Name
low-density lipoprotein receptor-related protein 2
NCBI Official Synonym Full Names
LDL receptor related protein 2
NCBI Official Symbol
LRP2
NCBI Official Synonym Symbols
DBS; GP330
NCBI Protein Information
low-density lipoprotein receptor-related protein 2
UniProt Protein Name
Low-density lipoprotein receptor-related protein 2
UniProt Gene Name
LRP2
UniProt Synonym Gene Names
LRP-2; gp330

NCBI Description

The protein encoded by this gene, low density lipoprotein-related protein 2 (LRP2) or megalin, is a multi-ligand endocytic receptor that is expressed in many different tissues but primarily in absorptive epithilial tissues such as the kidney. This glycoprotein has a large amino-terminal extracellular domain, a single transmembrane domain, and a short carboxy-terminal cytoplasmic tail. The extracellular ligand-binding-domains bind diverse macromolecules including albumin, apolipoproteins B and E, and lipoprotein lipase. The LRP2 protein is critical for the reuptake of numerous ligands, including lipoproteins, sterols, vitamin-binding proteins, and hormones. This protein also has a role in cell-signaling; extracellular ligands include parathyroid horomones and the morphogen sonic hedgehog while cytosolic ligands include MAP kinase scaffold proteins and JNK interacting proteins. Recycling of this membrane receptor is regulated by phosphorylation of its cytoplasmic domain. Mutations in this gene cause Donnai-Barrow syndrome (DBS) and facio-oculoacoustico-renal syndrome (FOAR).[provided by RefSeq, Aug 2009]

Uniprot Description

Multiligand endocytic receptor (). Acts together with CUBN to mediate endocytosis of high-density lipoproteins (). Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B (). In the kidney, mediates the tubular uptake and clearance of leptin (). Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium (). Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight (). Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells (). Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP (). Mediates renal uptake of metallothionein-bound heavy metals (PubMed:15126248). Together with CUBN, mediates renal reabsorption of myoglobin (). Mediates renal uptake and subsequent lysosomal degradation of APOM (). Plays a role in kidney selenium homeostasis by mediating renal endocytosis of selenoprotein SEPP1 (). Mediates renal uptake of the antiapoptotic protein BIRC5/survivin which may be important for functional integrity of the kidney (PubMed:23825075). Mediates renal uptake of matrix metalloproteinase MMP2 in complex with metalloproteinase inhibitor TIMP1 (). Mediates endocytosis of Sonic hedgehog protein N-product (ShhN), the active product of SHH (). Also mediates ShhN transcytosis (). In the embryonic neuroepithelium, mediates endocytic uptake and degradation of BMP4, is required for correct SHH localization in the ventral neural tube and plays a role in patterning of the ventral telencephalon (). Required at the onset of neurulation to sequester SHH on the apical surface of neuroepithelial cells of the rostral diencephalon ventral midline and to control PTCH1-dependent uptake and intracellular trafficking of SHH (). During neurulation, required in neuroepithelial cells for uptake of folate bound to the folate receptor FOLR1 which is necessary for neural tube closure (). In the adult brain, negatively regulates BMP signaling in the subependymal zone which enables neurogenesis to proceed (). In astrocytes, mediates endocytosis of ALB which is required for the synthesis of the neurotrophic factor oleic acid (). Involved in neurite branching (). During optic nerve development, required for SHH-mediated migration and proliferation of oligodendrocyte precursor cells (). Mediates endocytic uptake and clearance of SHH in the retinal margin which protects retinal progenitor cells from mitogenic stimuli and keeps them quiescent (). Plays a role in reproductive organ development by mediating uptake in reproductive tissues of androgen and estrogen bound to the sex hormone binding protein SHBG (). Mediates endocytosis of angiotensin-2 (). Also mediates endocytosis of angiotensis 1-7 (). Binds to the complex composed of beta-amyloid protein 40 and CLU/APOJ and mediates its endocytosis and lysosomal degradation (). Required for embryonic heart development (). Required for normal hearing, possibly through interaction with estrogen in the inner ear ().

Research Articles on LRP2

Similar Products

Product Notes

The LRP2 lrp2 (Catalog #AAA958530) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1186-1389aa; Partial. The amino acid sequence is listed below: NCTASQFKCA SGDKCIGVTN RCDGVFDCSD NSDEAGCPTR PPGMCHSDEF QCQEDGICIP NFWECDGHPD CLYGSDEHNA CVPKTCPSSY FHCDNGNCIH RAWLCDRDND CGDMSDEKDC PTQPFRCPSW QWQCLGHNIC VNLSVVCDGI FDCPNGTDES PLCNGNSCSD FNGGCTHECV QEPFGAKCLC PLGFLLANDS KTCE . It is sometimes possible for the material contained within the vial of "Low-density lipoprotein receptor-related protein 2 (LRP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.