Antiholin-like protein LrgA (lrgA) Recombinant Protein | ysbA recombinant protein
Recombinant Bacillus subtilis Antiholin-like protein LrgA (lrgA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Antiholin-like protein LrgA (lrgA); Recombinant Bacillus subtilis Antiholin-like protein LrgA (lrgA); ysbA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-146
Sequence
MSAKKVYGFLTQAFIFAVIMLVSNMIAAIVPIPIPASVVGLVLLFLLLCLKVIKLEQVETLGTSLTSLIGFLFVPSGISVMNSLGVMQQYGLQIVLVILLATIILLGATGLFSQLILSLSGKRKTEADMKTKTVQSPQNNNELVHH
Sequence Length
146
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for ysbA recombinant protein
lrgA; ysbA
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,711 Da
NCBI Official Full Name
murein hydrolase regulator LrgA
NCBI Official Symbol
ysbA
NCBI Protein Information
murein hydrolase regulator LrgA
UniProt Protein Name
Antiholin-like protein LrgA
UniProt Gene Name
lrgA
UniProt Synonym Gene Names
ysbA
UniProt Entry Name
LRGA_BACSU
Uniprot Description
Function: Inhibits the expression or activity of extracellular murein hydrolases by interacting, possibly with LrgB, with the holin-like protein CidA. The LrgAB and CidA proteins may affect the proton motive force of the membrane. May be involved in programmed cell death (PCD), possibly triggering PCD in response to antibiotics and environmental stresses
By similarity. HAMAP-Rule MF_01141
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential HAMAP-Rule MF_01141.
Sequence similarities: Belongs to the CidA/LrgA family. LrgA subfamily.
Similar Products
Product Notes
The ysbA lrga (Catalog #AAA1153107) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-146. The amino acid sequence is listed below: MSAKKVYGFL TQAFIFAVIM LVSNMIAAIV PIPIPASVVG LVLLFLLLCL KVIKLEQVET LGTSLTSLIG FLFVPSGISV MNSLGVMQQY GLQIVLVILL ATIILLGATG LFSQLILSLS GKRKTEADMK TKTVQSPQNN NELVHH. It is sometimes possible for the material contained within the vial of "Antiholin-like protein LrgA (lrgA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
