Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Antiholin-like protein LrgA (lrgA) Recombinant Protein | SAOUHSC_00232 recombinant protein

Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Antiholin-like protein LrgA (lrgA); Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA); Recombinant Antiholin-like protein LrgA (lrgA); Antiholin-like protein LrgA; SAOUHSC_00232 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-147
Sequence
MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVKLGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQIIMKVTSRSKGDKVTKKIKIEEAQAHD
Sequence Length
147
Species
Staphylococcus aureus (strain NCTC 8325)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,780 Da
NCBI Official Full Name
murein hydrolase regulator LrgA
NCBI Official Symbol
SAOUHSC_00232
NCBI Protein Information
murein hydrolase regulator LrgA
UniProt Protein Name
Antiholin-like protein LrgA
UniProt Gene Name
lrgA
UniProt Entry Name
LRGA_STAA8

Uniprot Description

Function: Inhibits the expression or activity of extracellular murein hydrolases by interacting, possibly with LrgB, with the holin-like proteins CidA and/or CidB. The LrgAB and CidAB proteins may affect the proton motive force of the membrane. Increases tolerance to penicillin possibly by inhibiting the formation of the CidAB holin-like complexes within the membrane, thus reducing penicillin-induced lethality. Possibly plays a role in programmed cell death (PCD), triggering PCD in response to penicillin, and possibly other antibiotics, and environmental stresses. Ref.3

Subcellular location: Cell membrane; Multi-pass membrane protein

Potential HAMAP-Rule MF_01141.

Induction: Regulated by the two-component system LytR/LytS. Ref.1

Sequence similarities: Belongs to the CidA/LrgA family. LrgA subfamily.

Research Articles on SAOUHSC_00232

Similar Products

Product Notes

The SAOUHSC_00232 lrga (Catalog #AAA1098554) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-147. The amino acid sequence is listed below: MVVKQQKDAS KPAHFFHQVI VIALVLFVSK IIESFMPIPM PASVIGLVLL FVLLCTGAVK LGEVEKVGTT LTNNIGLLFV PAGISVVNSL GVISQAPFLI IGLIIVSTIL LLICTGYVTQ IIMKVTSRSK GDKVTKKIKI EEAQAHD. It is sometimes possible for the material contained within the vial of "Antiholin-like protein LrgA (lrgA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.