Longitudinals lacking protein-like (lolal) Recombinant Protein | lolal recombinant protein
Recombinant Drosophila melanogaster Longitudinals lacking protein-like (lolal)
Gene Names
lolal; 25/12; anon-EST:fe3D3; anon-WO0172774.186; ban; Ban; bat; CG5738; DmelCG5738; EP0647; EP647; l(2)k02512; l(2)kO2512; Lolal; LOLAL
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Longitudinals lacking protein-like (lolal); Recombinant Drosophila melanogaster Longitudinals lacking protein-like (lolal); lolal recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-127, Full length protein
Sequence
MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG
Sequence Length
127
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,489 Da
NCBI Official Full Name
lola like, isoform E
NCBI Official Synonym Full Names
lola like
NCBI Official Symbol
lolal
NCBI Official Synonym Symbols
25/12; anon-EST:fe3D3; anon-WO0172774.186; ban; Ban; bat; CG5738; DmelCG5738; EP0647; EP647; l(2)k02512; l(2)kO2512; Lolal; LOLAL
NCBI Protein Information
CG5738 gene product from transcript CG5738-RA
UniProt Protein Name
Longitudinals lacking protein-like
Protein Family
UniProt Gene Name
lolal
UniProt Synonym Gene Names
Lola-like protein
Uniprot Description
Required, together with Trl, for maintaining the repressed state of target genes including homeotic genes Scr and Ubx. May also be involved in the activation of homeotic genes. Binds to a DNA Polycomb response element (PRE) at the bithorax complex. Also binds to polytene chromosomes at several hundred sites, many of which are shared with Trl and ph-p. Required during embryonic development.
Research Articles on lolal
Similar Products
Product Notes
The lolal lolal (Catalog #AAA1421749) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-127, Full length protein. The amino acid sequence is listed below: MMSSDQQFFL KWNDFQTNMV TSFRHLRDEK SFTDVTLACE GQTCKAHKMV LSACSPYFKA LLEENPSKHP IIILKDVSYI HLQAILEFMY AGEVNVSQEQ LPAFLKTADR LKVKGLAETP SSIKREG. It is sometimes possible for the material contained within the vial of "Longitudinals lacking protein-like (lolal), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
