Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leucyl-cystinyl aminopeptidase (LNPEP) Recombinant Protein | LNPEP recombinant protein

Recombinant Human Leucyl-cystinyl aminopeptidase (LNPEP) , partial

Gene Names
LNPEP; CAP; IRAP; PLAP; P-LAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leucyl-cystinyl aminopeptidase (LNPEP); Recombinant Human Leucyl-cystinyl aminopeptidase (LNPEP); partial; LNPEP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
132-552aa; Partial
Sequence
PRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKG
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LNPEP recombinant protein
This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-responsive glucose transporter GLUT4, or form a type II integral membrane glycoprotein. The protein catalyzes the final step in the conversion of angiotensinogen to angiotensin IV (AT4) and is also a receptor for AT4. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115,062 Da
NCBI Official Full Name
leucyl-cystinyl aminopeptidase isoform 1
NCBI Official Synonym Full Names
leucyl and cystinyl aminopeptidase
NCBI Official Symbol
LNPEP
NCBI Official Synonym Symbols
CAP; IRAP; PLAP; P-LAP
NCBI Protein Information
leucyl-cystinyl aminopeptidase
UniProt Protein Name
Leucyl-cystinyl aminopeptidase
UniProt Gene Name
LNPEP
UniProt Synonym Gene Names
OTASE; Cystinyl aminopeptidase; IRAP; OTase; P-LAP

NCBI Description

This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-responsive glucose transporter GLUT4, or form a type II integral membrane glycoprotein. The protein catalyzes the final step in the conversion of angiotensinogen to angiotensin IV (AT4) and is also a receptor for AT4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Release of an N-terminal amino acid, cleaves before cysteine, leucine as well as other amino acids. Degrades peptide hormones such as oxytocin, vasopressin and angiotensin III, and plays a role in maintaining homeostasis during pregnancy. May be involved in the inactivation of neuronal peptides in the brain. Cleaves Met-enkephalin and dynorphin. Binds angiotensin IV and may be the angiotensin IV receptor in the brain.

Research Articles on LNPEP

Similar Products

Product Notes

The LNPEP lnpep (Catalog #AAA1360634) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 132-552aa; Partial. The amino acid sequence is listed below: PRCTFTKEGC HKKNQSIGLI QPFATNGKLF PWAQIRLPTA VVPLRYELSL HPNLTSMTFR GSVTISVQAL QVTWNIILHS TGHNISRVTF MSAVSSQEKQ AEILEYAYHG QIAIVAPEAL LAGHNYTLKI EYSANISSSY YGFYGFSYTD ESNEKKYFAA TQFEPLAARS AFPCFDEPAF KATFIIKIIR DEQYTALSNM PKKSSVVLDD GLVQDEFSES VKMSTYLVAF IVGEMKNLSQ DVNGTLVSIY AVPEKIGQVH YALETTVKLL EFFQNYFEIQ YPLKKLDLVA IPDFEAGAME NWGLLTFREE TLLYDSNTSS MADRKLVTKI IAHELAHQWF GNLVTMKWWN DLWLNEGFAT FMEYFSLEKI FKELSSYEDF LDARFKTMKK DSLNSSHPIS SSVQSSEQIE EMFDSLSYFK G . It is sometimes possible for the material contained within the vial of "Leucyl-cystinyl aminopeptidase (LNPEP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.