Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

LIM domain transcription factor LMO4 (LMO4) Recombinant Protein | LMO4 recombinant protein

Recombinant Human LIM domain transcription factor LMO4 (LMO4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
LIM domain transcription factor LMO4 (LMO4); Recombinant Human LIM domain transcription factor LMO4 (LMO4); LIM domain transcription factor LMO4; Breast tumor autoantigen; LIM domain only protein 4; LMO-4; LMO4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-165aa; Full Length
Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Sequence Length
165
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for LMO4 recombinant protein
Probable transcriptional factor.
Product Categories/Family for LMO4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
LIM domain transcription factor LMO4
NCBI Official Synonym Full Names
LIM domain only 4
NCBI Official Symbol
LMO4
NCBI Protein Information
LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4
UniProt Protein Name
LIM domain transcription factor LMO4
UniProt Gene Name
LMO4
UniProt Synonym Gene Names
LMO-4
UniProt Entry Name
LMO4_HUMAN

NCBI Description

This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. [provided by RefSeq, Aug 2008]

Uniprot Description

LMO4: Probable transcriptional factor.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 1p22.3

Cellular Component: transcription factor complex

Molecular Function: zinc ion binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; thymus development; ventral spinal cord interneuron differentiation; regulation of cell activation; neural tube closure; regulation of cell fate specification; spinal cord association neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; spinal cord motor neuron differentiation; negative regulation of protein complex assembly

Research Articles on LMO4

Similar Products

Product Notes

The LMO4 lmo4 (Catalog #AAA966815) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-165aa; Full Length. The amino acid sequence is listed below: MVNPGSSSQP PPVTAGSLSW KRCAGCGGKI ADRFLLYAMD SYWHSRCLKC SCCQAQLGDI GTSCYTKSGM ILCRNDYIRL FGNSGACSAC GQSIPASELV MRAQGNVYHL KCFTCSTCRN RLVPGDRFHY INGSLFCEHD RPTALINGHL NSLQSNPLLP DQKVC. It is sometimes possible for the material contained within the vial of "LIM domain transcription factor LMO4 (LMO4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.