Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) Recombinant Protein | LITAF recombinant protein

Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF)

Cat. Num. AAA1446718

• Gene Names: LITAF; PIG7; SIMPLE; TP53I7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF); Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF); LITAF recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-161, Full length protein
• Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
• Sequence Length: 161

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for LITAF recombinant protein

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget s disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 210147505
• NCBI GeneID: 9516
• NCBI Accession #: NP_001129944.1
• NCBI GenBank Nucleotide #: NM_001136472.1
• UniProt Accession #: Q99732; Q05DW0; Q9C0L6; D3DUG1; G5E9K0
• Molecular Weight: 15,824 Da
• NCBI Official Full Name: lipopolysaccharide-induced tumor necrosis factor-alpha factor isoform 1
• NCBI Official Synonym Full Names: lipopolysaccharide induced TNF factor
• NCBI Official Symbol: LITAF
• NCBI Official Synonym Symbols: PIG7; SIMPLE; TP53I7
• NCBI Protein Information: lipopolysaccharide-induced tumor necrosis factor-alpha factor
• UniProt Protein Name: Lipopolysaccharide-induced tumor necrosis factor-alpha factor
• Protein Family: Lipopolysaccharide-induced tumor necrosis factor-alpha factor
• UniProt Gene Name: LITAF
• UniProt Synonym Gene Names: LPS-induced TNF-alpha factor

NCBI Description

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation (PubMed:23166352). Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades (PubMed:23166352). Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes (PubMed:23166352). Probably plays a role in regulating protein degradation via its interaction with NEDD4 (PubMed:15776429). May also contribute to the regulation of gene expression in the nucleus (PubMed:10200294, PubMed:15793005). Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines (PubMed:15793005). May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10 (PubMed:10200294, PubMed:15793005).