Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic (LFNR1) Recombinant Protein | LFNR1 recombinant protein
Recombinant Arabidopsis thaliana Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic (LFNR1)
Gene Names
FNR1; ATLFNR1; ferredoxin-NADP(+)-oxidoreductase 1; FERREDOXIN:NADP(H) OXIDOREDUCTASE; K2A18.27; K2A18_27; LEAF FNR 1; leaf-type chloroplast-targeted FNR 1; LFNR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ferredoxin--NADP reductase; leaf isozyme 1; chloroplastic (LFNR1); Recombinant Arabidopsis thaliana Ferredoxin--NADP reductase; LFNR1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
50-360, Full length protein
Sequence
VTTDTTEAPPVKVVKESKKQEEGIVVNKFKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGEVPYREGQSIGVIPEGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDGGEIVKGVCSNFLCDLKPGDEAKITGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEEHEDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKNPDNFRLDFAVSREQTNEKGEKMYIQTRMAEYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWLEYKKQLKRSEQWNVEVY
Sequence Length
311
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,326 Da
NCBI Official Full Name
ferredoxin-NADP[+]-oxidoreductase 1
NCBI Official Symbol
FNR1
NCBI Official Synonym Symbols
ATLFNR1; ferredoxin-NADP(+)-oxidoreductase 1; FERREDOXIN:NADP(H) OXIDOREDUCTASE; K2A18.27; K2A18_27; LEAF FNR 1; leaf-type chloroplast-targeted FNR 1; LFNR1
NCBI Protein Information
ferredoxin-NADP[+]-oxidoreductase 1
UniProt Protein Name
Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic
Protein Family
UniProt Gene Name
LFNR1
UniProt Synonym Gene Names
FNR-1
NCBI Description
Encodes a leaf-type ferredoxin:NADP(H) oxidoreductase. It is present in both chloroplast stroma and thylakoid membranes but is more abundant in the thylakoid. The affinity of this enzyme for ferredoxin is slightly, but significantly, higher than AtLFNR2, an isoform of the same enzyme. AtLFNR1 forms a heterodimer with AtFNR2 and is also a prerequisite to attach AtFNR2 to the thylakoid membrane.
Uniprot Description
Plays a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power.
Research Articles on LFNR1
Similar Products
Product Notes
The LFNR1 lfnr1 (Catalog #AAA1454900) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 50-360, Full length protein. The amino acid sequence is listed below: VTTDTTEAPP VKVVKESKKQ EEGIVVNKFK PKNPYTGRCL LNTKITGDDA PGETWHIVFT TEGEVPYREG QSIGVIPEGI DKNGKPHKLR LYSIASSAIG DFGDSKTVSL CVKRLVYTND GGEIVKGVCS NFLCDLKPGD EAKITGPVGK EMLMPKDPNA TIIMLGTGTG IAPFRSFLWK MFFEEHEDYK FNGLAWLFLG VPTSSSLLYK EEFEKMKEKN PDNFRLDFAV SREQTNEKGE KMYIQTRMAE YAEELWELLK KDNTFVYMCG LKGMEKGIDD IMVSLAAKDG IDWLEYKKQL KRSEQWNVEV Y. It is sometimes possible for the material contained within the vial of "Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic (LFNR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
