LETM1 domain-containing protein LETM2 (LETM2) Recombinant Protein | LETM2 recombinant protein
Recombinant Human LETM1 domain-containing protein LETM2, mitochondrial (LETM2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
LETM1 domain-containing protein LETM2 (LETM2); Recombinant Human LETM1 domain-containing protein LETM2; mitochondrial (LETM2); LETM2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
26-491aa; full length protein
Sequence
CSSYSPSCAFLHLPDSHLNKTCMKNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQ EVPGKPQLEQATKHPQVTSPQATKETGMEIKEGKQSYRQKIMDELKYYYNGFYLLWIDAK VAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEML PSTFESESKKEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSYVKQVQTG HKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKA DDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLL SRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTESKENMVDLAPQLKGTKDEDFIQPP PVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKGA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for LETM2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,909 Da
NCBI Official Full Name
LETM1 domain-containing protein LETM2, mitochondrial isoform 1
NCBI Official Synonym Full Names
leucine zipper and EF-hand containing transmembrane protein 2
NCBI Official Symbol
LETM2
NCBI Protein Information
LETM1 domain-containing protein LETM2, mitochondrial
UniProt Protein Name
LETM1 domain-containing protein LETM2, mitochondrial
Protein Family
UniProt Gene Name
LETM2
UniProt Entry Name
LETM2_HUMAN
Uniprot Description
LETM2: 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Mitochondrial; Membrane protein, integral
Chromosomal Location of Human Ortholog: 8p11.23
Cellular Component: integral to membrane; mitochondrial inner membrane
Molecular Function: ribosome binding
Similar Products
Product Notes
The LETM2 letm2 (Catalog #AAA7018293) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-491aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the LETM2 letm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CSSYSPSCAF LHLPDSHLNK TCMKNYESKK YSDPSQPGNT VLHPGTRLIQ KLHTSTCWLQ EVPGKPQLEQ ATKHPQVTSP QATKETGMEI KEGKQSYRQK IMDELKYYYN GFYLLWIDAK VAARMVWRLL HGQVLTRRER RRLLRTCVDF FRLVPFMVFL IVPFMEFLLP VFLKLFPEML PSTFESESKK EEKQKKKMAV KLELAKFLQE TMTEMARRNR AKMGDASTQL SSYVKQVQTG HKPSTKEIVR FSKLFEDQLA LEHLDRPQLV ALCKLLELQT FGTNNLLRFQ LLMKLKSIKA DDEIIAKEGV TALSVSELQA ACRARGMRSL GLTEEQLRQQ LTEWQDLHLK ENVPPSLLLL SRTFYLIDVK PKPIEIPLSG EAPKTDILVE LPTFTESKEN MVDLAPQLKG TKDEDFIQPP PVTSSPITPS TPISLPKGPI TSSEEPTLQA KSQMTAQNSK ASSKGA. It is sometimes possible for the material contained within the vial of "LETM1 domain-containing protein LETM2 (LETM2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
