Neutrophil gelatinase-associated lipocalin (Lcn2) Recombinant Protein | Lcn2 recombinant protein

Recombinant Rat Neutrophil gelatinase-associated lipocalin (Lcn2)

Cat. Num. AAA962556

• Gene Names: Lcn2; Sip24
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Neutrophil gelatinase-associated lipocalin (Lcn2); Recombinant Rat Neutrophil gelatinase-associated lipocalin (Lcn2); Lcn2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-198, Full length protein
• Sequence: QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN
• Sequence Length: 178

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 18543345
• NCBI GeneID: 170496
• NCBI Accession #: NP_570097.1
• NCBI GenBank Nucleotide #: NM_130741.1
• UniProt Accession #: P30152; Q5HZF1
• Molecular Weight: 22,476 Da
• NCBI Official Full Name: neutrophil gelatinase-associated lipocalin
• NCBI Official Synonym Full Names: lipocalin 2
• NCBI Official Symbol: Lcn2
• NCBI Official Synonym Symbols: Sip24
• NCBI Protein Information: neutrophil gelatinase-associated lipocalin
• UniProt Protein Name: Neutrophil gelatinase-associated lipocalin
• Protein Family: Neutrophil gelatinase-associated lipocalin
• UniProt Gene Name: Lcn2
• UniProt Synonym Gene Names: NGAL

NCBI Description

mouse homolog plays a role in IL3 withdrawal-induced apoptosis [RGD, Feb 2006]

Uniprot Description

Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth ().