NGAL Recombinant Protein | LCN2 recombinant protein

Recombinant human NGAL protein

Cat. Num. AAA717250

• Gene Names: LCN2; 24p3; MSFI; NGAL
• Applications: ELISA, Western Blot
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: NGAL; Recombinant human NGAL protein; 25 kDa alpha-2-microglobulin-related subunit of MMP-9 Lipocalin-2 Oncogene 24p3 p25; LCN2 recombinant protein

• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: AQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

• Applicable Applications for LCN2 recombinant protein: ELISA, Western Blot
• Preparation and Storage: Store working aliquots at 4 degree C for up to one week. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended.

Related Product Information for LCN2 recombinant protein

Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth.

References

[1] "Cloning and expression of human neutrophil lipocalin cDNA derived from bone marrow and ovarian cancer cells." Bartsch S., Tschesche H. FEBS Lett. 357:255-259(1995)
[2] "Isolation and primary structure of NGAL, a novel protein associated with human neutrophil gelatinase." Kjeldsen L., Johnsen A.H., Sengelov H., Borregaard N. J. Biol. Chem. 268:10425-10432(1993)

NCBI and Uniprot Product Information

• NCBI GI #: 108936956
• NCBI GeneID: 3934
• NCBI Accession #: NP_005555.2
• NCBI GenBank Nucleotide #: NM_005564.3
• UniProt Accession #: P80188; P30150; Q5SYV9; Q5SYW0; Q6FGL5; Q92683; A6NII8; B4DWV4; B7ZAA2
• Molecular Weight: 14 KD
• NCBI Official Full Name: Homo sapiens lipocalin 2 (LCN2), mRNA
• NCBI Official Synonym Full Names: lipocalin 2
• NCBI Official Symbol: LCN2
• NCBI Official Synonym Symbols: 24p3; MSFI; NGAL
• NCBI Protein Information: neutrophil gelatinase-associated lipocalin; p25; lipocalin-2; siderocalin; oncogene 24p3; OTTHUMP00000022238; OTTHUMP00000022239; OTTHUMP00000022240; migration-stimulating factor inhibitor; 25 kDa alpha-2-microglobulin-related subunit of MMP-9
• UniProt Protein Name: Neutrophil gelatinase-associated lipocalin
• Protein Family: Neutrophil gelatinase-associated lipocalin
• UniProt Gene Name: LCN2
• UniProt Synonym Gene Names: HNL; NGAL
• UniProt Entry Name: NGAL_HUMAN

Uniprot Description

Function: Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth. Ref.11Subunit structure: Homodimer; disulfide-linked. Heterodimer; disulfide-linked with MMP9. Ref.19Subcellular location: Secreted. Note: Upon binding to the SLC22A17 (24p3R) receptor, it is internalized. Ref.11Tissue specificity: Expressed in bone marrow and in tissues that are prone to exposure to microorganism. High expression is found in bone marrow as well as in uterus, prostate, salivary gland, stomach, appendix, colon, trachea and lung. Not found in the small intestine or peripheral blood leukocytes. Ref.2Induction: Expression is activated by the oncoprotein BCR-ABL; BCR-ABL misregulates expression via the JAK/STAT pathway and binding of STAT5A to the promoter. Ref.15Sequence similarities: Belongs to the calycin superfamily. Lipocalin family.Sequence caution: The sequence CAI13824.1 differs from that shown. Reason: Erroneous gene model prediction.