Phosphatidylcholine-sterol acyltransferase (LCAT) Recombinant Protein | LCAT recombinant protein
Recombinant Chicken Phosphatidylcholine-sterol acyltransferase (LCAT)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylcholine-sterol acyltransferase (LCAT); Recombinant Chicken Phosphatidylcholine-sterol acyltransferase (LCAT); LCAT recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-413, Full length protein
Sequence
FWLFNVLFPPTTTPEAPPTNSTPPWCLVPGFLGNQLEAKLDKPDVVNWMCYRKTEDYFTIWLNLNTFLPVGVDCWIDNTRVVYNRTARKMTNAPGVHIRVPGFGKTYSVEYLDQSKLAGYLHTLVQNLVNNGYVRDQTVRAAPYDWRVGPQEQPEYFQNLKALIEEMHDEYQQRVFLIGHSMGNLNVLYFLLQQKQAWKDQYIGGFISLGAPWGGSVKPLRVLASGDNQGIPLMSNIKLREEQRMTTTSPWMFPTSLAWPEDHVFISTPSYNYTYRDYQRFFTDVNLEDGWYMWEDMKDLLKGLPPPGVDTYCLYGTGYPTVETYIYDEHFPYEDPVDMIYGDGDDTVNKRSSELCKRWRNQQKQKVHVQELRGIDHLNMVFSNLTLTLHQ
Sequence Length
391
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LCAT recombinant protein
This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,804 Da
NCBI Official Full Name
phosphatidylcholine-sterol acyltransferase
NCBI Official Synonym Full Names
lecithin-cholesterol acyltransferase
NCBI Official Symbol
LCAT
NCBI Protein Information
phosphatidylcholine-sterol acyltransferase
UniProt Protein Name
Phosphatidylcholine-sterol acyltransferase
UniProt Gene Name
LCAT
Uniprot Description
Central enzyme in the extracellular metabolism of plasma lipoproteins. Synthesized mainly in the liver and secreted into plasma where it converts cholesterol and phosphatidylcholines (lecithins) to cholesteryl esters and lysophosphatidylcholines on the surface of high and low density lipoproteins (HDLs and LDLs). The cholesterol ester is then transported back to the liver. Also produced in the brain by primary astrocytes, and esterifies free cholesterol on nascent APOE-containing lipoproteins secreted from glia and influences cerebral spinal fluid (CSF) APOE- and APOA1 levels. Together with APOE and the cholesterol transporter ABCA1, plays a key role in the maturation of glial-derived, nascent lipoproteins. Required for remodeling high-density lipoprotein particles into their spherical forms (). Has a preference for plasma 16:0-18:2 or 18:O-18:2 phosphatidylcholines (PubMed:8820107).
Similar Products
Product Notes
The LCAT lcat (Catalog #AAA951848) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-413, Full length protein. The amino acid sequence is listed below: FWLFNVLFPP TTTPEAPPTN STPPWCLVPG FLGNQLEAKL DKPDVVNWMC YRKTEDYFTI WLNLNTFLPV GVDCWIDNTR VVYNRTARKM TNAPGVHIRV PGFGKTYSVE YLDQSKLAGY LHTLVQNLVN NGYVRDQTVR AAPYDWRVGP QEQPEYFQNL KALIEEMHDE YQQRVFLIGH SMGNLNVLYF LLQQKQAWKD QYIGGFISLG APWGGSVKPL RVLASGDNQG IPLMSNIKLR EEQRMTTTSP WMFPTSLAWP EDHVFISTPS YNYTYRDYQR FFTDVNLEDG WYMWEDMKDL LKGLPPPGVD TYCLYGTGYP TVETYIYDEH FPYEDPVDMI YGDGDDTVNK RSSELCKRWR NQQKQKVHVQ ELRGIDHLNM VFSNLTLTLH Q. It is sometimes possible for the material contained within the vial of "Phosphatidylcholine-sterol acyltransferase (LCAT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
