Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipopolysaccharide-binding protein (LBP) Recombinant Protein | LBP recombinant protein

Recombinant Human Lipopolysaccharide-binding protein (LBP), partial

Gene Names
LBP; BPIFD2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipopolysaccharide-binding protein (LBP); Recombinant Human Lipopolysaccharide-binding protein (LBP); partial; Lipopolysaccharide-binding protein(LBP); LBP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
304-414aa, Partial
Sequence
TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES
Species
Homo sapiens (Human)
Relevance
Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria (PubMed:7517398, PubMed:24120359). Acts as an affinity enhancer for CD14, facilitating its association with LPS. Promotes the release of cytokines in response to bacterial lipopolysaccharide (PubMed:7517398, PubMed:24120359).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for LBP recombinant protein
References
"The crystal structure of lipopolysaccharide binding protein reveals the location of a frequent mutation that impairs innate immunity."Eckert J.K., Kim Y.J., Kim J.I., Guertler K., Oh D.Y., Sur S., Lundvall L., Hamann L., van der Ploeg A., Pickkers P., Giamarellos-Bourboulis E., Kubarenko A.V., Weber A.N., Kabesch M., Kumpf O., An H.J., Lee J.O., Schumann R.R.Immunity 39:647-660(2013)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,384 Da
NCBI Official Full Name
lipopolysaccharide-binding protein
NCBI Official Synonym Full Names
lipopolysaccharide binding protein
NCBI Official Symbol
LBP
NCBI Official Synonym Symbols
BPIFD2
NCBI Protein Information
lipopolysaccharide-binding protein; LPS-binding protein; BPI fold containing family D, member 2
UniProt Protein Name
Lipopolysaccharide-binding protein
UniProt Gene Name
LBP
UniProt Synonym Gene Names
LBP
UniProt Entry Name
LBP_HUMAN

NCBI Description

The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). [provided by RefSeq, Apr 2012]

Uniprot Description

LBP: Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. The LBP/LPS complex seems to interact with the CD14 receptor. Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20q11.23

Cellular Component: extracellular space; cell surface; extracellular region

Molecular Function: protein binding; lipopolysaccharide binding; receptor binding

Biological Process: positive regulation of tumor necrosis factor biosynthetic process; detection of molecule of bacterial origin; positive regulation of toll-like receptor 4 signaling pathway; positive regulation of interleukin-6 production; response to lipopolysaccharide; negative regulation of tumor necrosis factor production; positive regulation of tumor necrosis factor production; defense response to Gram-negative bacterium; leukocyte chemotaxis during inflammatory response; positive regulation of chemokine production; positive regulation of interleukin-8 production; lipopolysaccharide transport; defense response to Gram-positive bacterium; macrophage activation during immune response; acute-phase response; toll-like receptor signaling pathway; lipopolysaccharide-mediated signaling pathway; cellular defense response; innate immune response; opsonization; toll-like receptor 4 signaling pathway; positive regulation of macrophage activation

Research Articles on LBP

Similar Products

Product Notes

The LBP lbp (Catalog #AAA9018508) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 304-414aa, Partial. The amino acid sequence is listed below: TDDMIPPDSN IRLTTKSFRP FVPRLARLYP NMNLELQGSV PSAPLLNFSP GNLSVDPYME IDAFVLLPSS SKEPVFRLSV ATNVSATLTF NTSKITGFLK PGKVKVELKE S. It is sometimes possible for the material contained within the vial of "Lipopolysaccharide-binding protein (LBP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.