Laminin subunit alpha (LanA) Recombinant Protein | LanA recombinant protein
Recombinant Drosophila melanogaster Laminin subunit alpha (LanA), partial
Gene Names
LanA; 5]]; alpha3/5; alpha[[3; CG10236; CT28769; DmelCG10236; FBgn0002526; FBtr0077014; hdln; Lam; Lam-A; lamA; LamA; laminin alpha3/5; Lan; lanA; LM-A/alpha1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Laminin subunit alpha (LanA); Recombinant Drosophila melanogaster Laminin subunit alpha (LanA); partial; LanA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-275aa; Partial
Sequence
ELTPPYFNLATGRKIYATATCGQDTDGPELYCKLVGANTEHDHIDYSVIQGQVCDYCDPTVPERNHPPENAIDGTEAWWQSPPLSRGMKFNEVNLTINFEQEFHVAYLFIRMGNSPRPGLWTLEKSTDYGKTWTPWQHFSDTPADCETYFGKDTYKPITRDDDVICTTEYSKIVPLENGEIPVMLLNERPSSTNYFNSTVLQEWTRATNVRIRLLRTKNLLGHLMSVARQDPTVTRRYFYSIKDISIGGRCMC
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
411,157 Da
NCBI Official Full Name
laminin A
NCBI Official Synonym Full Names
Laminin A
NCBI Official Symbol
LanA
NCBI Official Synonym Symbols
5]]; alpha3/5; alpha[[3; CG10236; CT28769; DmelCG10236; FBgn0002526; FBtr0077014; hdln; Lam; Lam-A; lamA; LamA; laminin alpha3/5; Lan; lanA; LM-A/alpha1
NCBI Protein Information
CG10236 gene product from transcript CG10236-RA
UniProt Protein Name
Laminin subunit alpha
Protein Family
UniProt Gene Name
LanA
UniProt Synonym Gene Names
lamA
Uniprot Description
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Activates presynaptic signaling involving integrin alpha-PS3/beta-nu and Fak to suppress neuromuscular junction (NMJ) growth during larval development and during low crawling activity, but not during higher-crawling conditions. Mediates, together with integrin alpha-PS3/beta-nu, glutamate receptor-modulated NMJ growth.
Research Articles on LanA
Similar Products
Product Notes
The LanA lana (Catalog #AAA1021815) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-275aa; Partial. The amino acid sequence is listed below: ELTPPYFNLA TGRKIYATAT CGQDTDGPEL YCKLVGANTE HDHIDYSVIQ GQVCDYCDPT VPERNHPPEN AIDGTEAWWQ SPPLSRGMKF NEVNLTINFE QEFHVAYLFI RMGNSPRPGL WTLEKSTDYG KTWTPWQHFS DTPADCETYF GKDTYKPITR DDDVICTTEY SKIVPLENGE IPVMLLNERP SSTNYFNSTV LQEWTRATNV RIRLLRTKNL LGHLMSVARQ DPTVTRRYFY SIKDISIGGR CMC . It is sometimes possible for the material contained within the vial of "Laminin subunit alpha (LanA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
