Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lysosome-associated membrane glycoprotein 2 (LAMP2) Recombinant Protein | Lgpb recombinant protein

Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 2 (LAMP2)

Gene Names
Lgpb; LAMP2; LGP-B; LAMP-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysosome-associated membrane glycoprotein 2 (LAMP2); Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 2 (LAMP2); Recombinant Lysosome-associated membrane glycoprotein 2 (LAMP2); Lysosome-associated membrane glycoprotein 2; LAMP-2; Lysosome-associated membrane protein 2; CD107 antigen-like family member B Lysosomal membrane glycoprotein B; LGP-B CD_antigen= CD107b; Lgpb recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-410
Sequence
FELNLPDSKATCLFAKWKMNFTISYETTTNKTLKTVTISEPHNVTYNGSSCGDDQGVAKIAVQFGSTVSWNVTFTKEESHYVIGSIWLVYNTSDNTTFPGAIPKGSATVISSQSIEIPLDDIFRCNSLLTFKTGNVVQNYWDIHLQAFVQNGTVSKEEFVCEEDKSVTTVRPIIHTTVPPPTTTPTPLPPKVGNYSVSNGNATCLLATMGLQLNVTEEKVPFIFNINPSTTNFTGSCHPQTAQLRLNNSQIKYLDFIFAVKSESHFYLKEVNVSMYMANGSVFSVANNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGKYATAQDCSADEDNFLVPIAVGAALAGVLALVLLAYFIGLKRHHTGYEQF
Sequence Length
410
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,028 Da
NCBI Official Full Name
lysosome-associated membrane glycoprotein 2
NCBI Official Symbol
Lgpb
NCBI Official Synonym Symbols
LAMP2; LGP-B; LAMP-2
NCBI Protein Information
lysosome-associated membrane glycoprotein 2; CD107 antigen-like family member B; Lysosome-associated membrane protein 2
UniProt Protein Name
Lysosome-associated membrane glycoprotein 2
UniProt Gene Name
LAMP2
UniProt Synonym Gene Names
LGPB; LAMP-2; Lysosome-associated membrane protein 2; LGP-B
UniProt Entry Name
LAMP2_CRIGR

Uniprot Description

Function: Implicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter- and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens

By similarity.

Subcellular location: Cell membrane; Single-pass type I membrane protein

By similarity. Endosome membrane; Single-pass type I membrane protein

By similarity. Lysosome membrane; Single-pass type I membrane protein

By similarity. Note: This protein shuttles between lysosomes, endosomes, and the plasma membrane

By similarity.

Post-translational modification: O- and N-glycosylated; some of the N-glycans attached to Lamp-2 are polylactosaminoglycans

By similarity.

Sequence similarities: Belongs to the LAMP family.

Similar Products

Product Notes

The Lgpb lamp2 (Catalog #AAA1083429) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-410. The amino acid sequence is listed below: FELNLPDSKA TCLFAKWKMN FTISYETTTN KTLKTVTISE PHNVTYNGSS CGDDQGVAKI AVQFGSTVSW NVTFTKEESH YVIGSIWLVY NTSDNTTFPG AIPKGSATVI SSQSIEIPLD DIFRCNSLLT FKTGNVVQNY WDIHLQAFVQ NGTVSKEEFV CEEDKSVTTV RPIIHTTVPP PTTTPTPLPP KVGNYSVSNG NATCLLATMG LQLNVTEEKV PFIFNINPST TNFTGSCHPQ TAQLRLNNSQ IKYLDFIFAV KSESHFYLKE VNVSMYMANG SVFSVANNNL SFWDAPLGSS YMCNKEQVVS VSRTFQINTF NLKVQPFNVT KGKYATAQDC SADEDNFLVP IAVGAALAGV LALVLLAYFI GLKRHHTGYE QF. It is sometimes possible for the material contained within the vial of "Lysosome-associated membrane glycoprotein 2 (LAMP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.