Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lysosome-associated membrane glycoprotein 2 Recombinant Protein | LAMP2 recombinant protein

Lysosome-associated membrane glycoprotein 2

Gene Names
Lamp2; Lgpb; LGP-B; LAMP-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysosome-associated membrane glycoprotein 2; LAMP2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
29-410aa; full length protein
Sequence
FELNLPDSKATCLFAKWKMNFTISYETTTNKTLKTVTISEPHNVTYNGSSCGDDQGVAKIAVQFGSTVSWNVTFTKEESHYVIGSIWLVYNTSDNTTFPGAIPKGSATVISSQSIEIPLDDIFRCNSLLTFKTGNVVQNYWDIHLQAFVQNGTVSKEEFVCEEDKSVTTVRPIIHTTVPPPTTTPTPLPPKVGNYSVSNGNATCLLATMGLQLNVTEEKVPFIFNINPSTTNFTGSCHPQTAQLRLNNSQIKYLDFIFAVKSESHFYLKEVNVSMYMANGSVFSVANNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGKYATAQDCSADEDNFLVPIAVGAALAGVLALVLLAYFIGLKRHHTGYEQF
Sequence Length
Full Length Protein
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for LAMP2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for LAMP2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,028 Da
NCBI Official Full Name
lysosome-associated membrane glycoprotein 2
NCBI Official Symbol
Lamp2
NCBI Official Synonym Symbols
Lgpb; LGP-B; LAMP-2
NCBI Protein Information
lysosome-associated membrane glycoprotein 2
UniProt Protein Name
Lysosome-associated membrane glycoprotein 2
UniProt Gene Name
LAMP2
UniProt Synonym Gene Names
LGPB; LAMP-2; Lysosome-associated membrane protein 2; LGP-B
UniProt Entry Name
LAMP2_CRIGR

Uniprot Description

Implicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter- and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens ().

Similar Products

Product Notes

The LAMP2 lamp2 (Catalog #AAA7043012) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-410aa; full length protein. The amino acid sequence is listed below: FELNLPDSKA TCLFAKWKMN FTISYETTTN KTLKTVTISE PHNVTYNGSS CGDDQGVAKI AVQFGSTVSW NVTFTKEESH YVIGSIWLVY NTSDNTTFPG AIPKGSATVI SSQSIEIPLD DIFRCNSLLT FKTGNVVQNY WDIHLQAFVQ NGTVSKEEFV CEEDKSVTTV RPIIHTTVPP PTTTPTPLPP KVGNYSVSNG NATCLLATMG LQLNVTEEKV PFIFNINPST TNFTGSCHPQ TAQLRLNNSQ IKYLDFIFAV KSESHFYLKE VNVSMYMANG SVFSVANNNL SFWDAPLGSS YMCNKEQVVS VSRTFQINTF NLKVQPFNVT KGKYATAQDC SADEDNFLVP IAVGAALAGV LALVLLAYFI GLKRHHTGYE QF. It is sometimes possible for the material contained within the vial of "Lysosome-associated membrane glycoprotein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.