Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lysosome-associated membrane glycoprotein 1 (Lamp1) Recombinant Protein | Lamp1 recombinant protein

Recombinant Mouse Lysosome-associated membrane glycoprotein 1 (Lamp1)

Gene Names
Lamp1; CD107a; Lamp-1; AI196048
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysosome-associated membrane glycoprotein 1 (Lamp1); Recombinant Mouse Lysosome-associated membrane glycoprotein 1 (Lamp1); Lamp1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-406
Sequence
LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
Sequence Length
406
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Lamp1 recombinant protein
Lamp1; Lamp-1

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,865 Da
NCBI Official Full Name
lysosome-associated membrane glycoprotein 1
NCBI Official Synonym Full Names
lysosomal-associated membrane protein 1
NCBI Official Symbol
Lamp1
NCBI Official Synonym Symbols
CD107a; Lamp-1; AI196048
NCBI Protein Information
lysosome-associated membrane glycoprotein 1; P2B; LGP-A; Lamp I; LGP-120; lysosomal membrane glycoprotein 1; lysosomal membrane glycoprotein A; CD107 antigen-like family member A; lysosome-associated membrane protein 1; 120 kDa lysosomal membrane glycoprotein; LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 1 PRECURSOR (LAMP-1) (LGP-A) (LGP-120) (CD107A) (P2B)
UniProt Protein Name
Lysosome-associated membrane glycoprotein 1
UniProt Gene Name
Lamp1
UniProt Synonym Gene Names
Lamp-1; LAMP-1; Lysosome-associated membrane protein 1; LGP-A
UniProt Entry Name
LAMP1_MOUSE

Uniprot Description

LAMP1: Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis. Belongs to the LAMP family.

Protein type: Membrane protein, integral

Cellular Component: cell surface; lysosome; dendrite; integral to membrane; multivesicular body; synaptic vesicle; membrane; cell soma; cytoplasm; late endosome; plasma membrane; melanosome; vacuole; cytoplasmic vesicle; vesicle; sarcolemma; endosome; external side of plasma membrane

Molecular Function: protein domain specific binding; protein binding; enzyme binding

Biological Process: positive regulation of natural killer cell degranulation; induction of apoptosis by granzyme; protein stabilization; autophagic cell death; spermatogenesis; positive regulation of natural killer cell mediated cytotoxicity

Research Articles on Lamp1

Similar Products

Product Notes

The Lamp1 lamp1 (Catalog #AAA951081) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-406. The amino acid sequence is listed below: LFEVKNNGTT CIMASFSASF LTTYETANGS QIVNISLPAS AEVLKNGSSC GKENVSDPSL TITFGRGYLL TLNFTKNTTR YSVQHMYFTY NLSDTEHFPN AISKEIYTMD STTDIKADIN KAYRCVSDIR VYMKNVTVVL RDATIQAYLS SGNFSKEETH CTQDGPSPTT GPPSPSPPLV PTNPTVSKYN VTGNNGTCLL ASMALQLNIT YLKKDNKTVT RAFNISPNDT SSGSCGINLV TLKVENKNRA LELQFGMNAS SSLFFLQGVR LNMTLPDALV PTFSISNHSL KALQATVGNS YKCNTEEHIF VSKMLSLNVF SVQVQAFKVD SDRFGSVEEC VQDGNNMLIP IAVGGALAGL VLIVLIAYLI GRKRSHAGYQ TI. It is sometimes possible for the material contained within the vial of "Lysosome-associated membrane glycoprotein 1 (Lamp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.