Laccase domain-containing protein 1 (Lacc1) Recombinant Protein | Lacc1 recombinant protein
Recombinant Mouse Laccase domain-containing protein 1 (Lacc1)
Gene Names
Lacc1; 9030625A04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Laccase domain-containing protein 1 (Lacc1); Recombinant Mouse Laccase domain-containing protein 1 (Lacc1); Lacc1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-430, full length protein
Sequence
MAEAVLIDLSGLQLNAQKNCHETLLETLDGIHYHHAPKAKFLCIICCRNASKEKDGEYGLCELEAGNGFSRLAGKFETVSHPCLAASLYTIKQKIDEENLSCIKVIVPEHRKLLMKAYVGQLFTEVYEFEFEDLQGAWRDSLLKPSTGINVTTTQELEDIQHEIETYLRSLPALKGDLTIVTSPLIPDNFLHGFTTRTGGISSVPTLSSLNLFSSSKRRDPKVVVQENVRRLANAAGFNAEKFYRIKTDHASEVWVMGKKEPESYDGIVTNQRGVTITALGADCIPIVFADPVKKACGVAHSGWKGTLLGVAMATVNAMIAEYGCDVEDIIVVLGPSVGSCCFTLPKESAVSFHSLHPSCVRHFDSPRPYVDIRKATRILLERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE
Sequence Length
430
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,514 Da
NCBI Official Full Name
laccase domain-containing protein 1
NCBI Official Synonym Full Names
laccase (multicopper oxidoreductase) domain containing 1
NCBI Official Symbol
Lacc1
NCBI Official Synonym Symbols
9030625A04Rik
NCBI Protein Information
laccase domain-containing protein 1
UniProt Protein Name
Laccase domain-containing protein 1
Protein Family
UniProt Gene Name
Lacc1
Uniprot Description
Central regulator of the metabolic function and bioenergetic state of macrophages. In macrophages, promotes flux through de novo lipogenesis to concomitantly drive high levels of both fatty-acid oxidation and glycolysis.
Research Articles on Lacc1
Similar Products
Product Notes
The Lacc1 lacc1 (Catalog #AAA1323538) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-430, full length protein. The amino acid sequence is listed below: MAEAVLIDLS GLQLNAQKNC HETLLETLDG IHYHHAPKAK FLCIICCRNA SKEKDGEYGL CELEAGNGFS RLAGKFETVS HPCLAASLYT IKQKIDEENL SCIKVIVPEH RKLLMKAYVG QLFTEVYEFE FEDLQGAWRD SLLKPSTGIN VTTTQELEDI QHEIETYLRS LPALKGDLTI VTSPLIPDNF LHGFTTRTGG ISSVPTLSSL NLFSSSKRRD PKVVVQENVR RLANAAGFNA EKFYRIKTDH ASEVWVMGKK EPESYDGIVT NQRGVTITAL GADCIPIVFA DPVKKACGVA HSGWKGTLLG VAMATVNAMI AEYGCDVEDI IVVLGPSVGS CCFTLPKESA VSFHSLHPSC VRHFDSPRPY VDIRKATRIL LERGGILPQN IQDQKEDLDL CTSCHPEKFF SHVRDGLNFG TQIGFISLRE. It is sometimes possible for the material contained within the vial of "Laccase domain-containing protein 1 (Lacc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
