Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD171/N-CAML1 recombinant protein

CD171/N-CAML1 Recombinant Protein

Gene Names
L1CAM; S10; HSAS; MASA; MIC5; SPG1; CAML1; CD171; HSAS1; N-CAML1; NCAM-L1; N-CAM-L1
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD171/N-CAML1; CD171/N-CAML1 Recombinant Protein; CD171/N-CAML1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
QGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQVKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNGRGSGPASEFTFSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDEGGKGQLSFNLRDPELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
993
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD171/N-CAML1 recombinant protein
Background: Neural cell adhesion molecule L1 (NCAM-L1/L1CAM) is a single pass transmembrane glycoprotein member of the immunoglobulin superfamily, containing six amino-terminal extracellular Ig-like domains followed by five fibronectin type-III domains. NCAM-L1 is mainly expressed in the brain, and plays an important role in the developing nervous system, with involvement in neurite fasciculation and outgrowth, myelination, neuronal migration, and neuronal cell adhesion. Mutations in the NCAM-L1 gene cause varying degrees of neurological disease including X-linked hydrocephalus, MASA syndrome, spastic paraplegia type 1, and X-linked corpus callosum agenesis, together known as L1 syndrome. Apart from the nervous system, NCAM-L1 is overexpressed in many cancers and supports a poor prognosis by facilitating aggressive tumor growth, metastasis and chemoresistance.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140,003 Da
NCBI Official Full Name
neural cell adhesion molecule L1 isoform 1
NCBI Official Synonym Full Names
L1 cell adhesion molecule
NCBI Official Symbol
L1CAM
NCBI Official Synonym Symbols
S10; HSAS; MASA; MIC5; SPG1; CAML1; CD171; HSAS1; N-CAML1; NCAM-L1; N-CAM-L1
NCBI Protein Information
neural cell adhesion molecule L1; antigen identified by monoclonal antibody R1
UniProt Protein Name
Neural cell adhesion molecule L1
UniProt Gene Name
L1CAM
UniProt Synonym Gene Names
CAML1; MIC5; N-CAM-L1; NCAM-L1
UniProt Entry Name
L1CAM_HUMAN

NCBI Description

The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons. [provided by RefSeq, May 2013]

Uniprot Description

NCAM-L1: cell adhesion molecule with an important role in the development of the nervous system. Involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. Binds to axonin on neurons. Two splice-variant isoforms have been described.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: presynaptic membrane; cell surface; focal adhesion; plasma membrane; integral to membrane; terminal button; external side of plasma membrane

Molecular Function: integrin binding; identical protein binding; protein self-association; sialic acid binding

Biological Process: nervous system development; axon guidance; positive regulation of calcium-mediated signaling; chemotaxis; heterophilic cell adhesion; leukocyte adhesion; cell surface receptor linked signal transduction; homotypic cell-cell adhesion; cell-cell adhesion mediated by integrin; positive regulation of cell-cell adhesion; cell adhesion; blood coagulation; homophilic cell adhesion; leukocyte migration

Disease: Hydrocephalus Due To Congenital Stenosis Of Aqueduct Of Sylvius; Corpus Callosum, Partial Agenesis Of, X-linked; Masa Syndrome

Research Articles on CD171/N-CAML1

Similar Products

Product Notes

The CD171/N-CAML1 l1cam (Catalog #AAA3003511) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QGKGPEPQVT IGYSGEDYPQ AIPELEGIEI LNSSAVLVKW RPVDLAQVKG HLRGYNVTYW REGSQRKHSK RHIHKDHVVV PANTTSVILS GLRPYSSYHL EVQAFNGRGS GPASEFTFST PEGVPGHPEA LHLECQSNTS LLLRWQPPLS HNGVLTGYVL SYHPLDEGGK GQLSFNLRDP ELRTHNLTDL SPHLRYRFQL QATTKEGPGE AIVREGGTMA LSGISDFGNI SATAGENYSV VSWVPKEGQC NFRFHILFKA LGEEKGGASL SPQYVSYNQS SYTQWDLQPD TDYEIHLFKE RMFRHQMAVK TNGTGRVRLP PAGFATE. It is sometimes possible for the material contained within the vial of "CD171/N-CAML1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.