Keratin, type II cytoskeletal 2 oral (KRT76) Recombinant Protein | KRT76 recombinant protein
Recombinant Human Keratin, type II cytoskeletal 2 oral (KRT76)
Gene Names
KRT76; KRT2B; KRT2P; HUMCYT2A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratin; type II cytoskeletal 2 oral (KRT76); Recombinant Human Keratin; KRT76 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-638, Full length protein
Sequence
MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDLGSIIAEVRAQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYGVSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK
Sequence Length
638
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for KRT76 recombinant protein
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,841 Da
NCBI Official Full Name
keratin, type II cytoskeletal 2 oral
NCBI Official Synonym Full Names
keratin 76
NCBI Official Symbol
KRT76
NCBI Official Synonym Symbols
KRT2B; KRT2P; HUMCYT2A
NCBI Protein Information
keratin, type II cytoskeletal 2 oral
UniProt Protein Name
Keratin, type II cytoskeletal 2 oral
Protein Family
UniProt Gene Name
KRT76
UniProt Synonym Gene Names
KRT2B; KRT2P; CK-2P; K2P; K76
NCBI Description
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13. [provided by RefSeq, Jun 2009]
Uniprot Description
Probably contributes to terminal cornification.
Similar Products
Product Notes
The KRT76 krt76 (Catalog #AAA953813) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-638, Full length protein. The amino acid sequence is listed below: MNRQVCKKSF SGRSQGFSGR SAVVSGSSRM SCVARSGGAG GGACGFRSGA GSFGSRSLYN LGSNKSISIS VAAGSSRAGG FGGGRSSCGF AGGYGGGFGG SYGGGFGGGR GVGSGFGGAG GFGGAGGFGG PGVFGGPGSF GGPGGFGPGG FPGGIQEVIV NQSLLQPLNV EIDPQIGQVK AQEREQIKTL NNKFASFIDK VRFLEQQNKV LETKWELLQQ QTTGSGPSSL EPCFESYISF LCKQLDSLLG ERGNLEGELK SMQDLVEDFK KKYEDEINKR TAAENEFVGL KKDVDAAFMN KVELQAKVDS LTDEVSFLRT LYEMELSQMQ SHASDTSVVL SMDNNRCLDL GSIIAEVRAQ YEEIAQRSKS EAEALYQTKL GELQTTAGRH GDDLRNTKSE IMELNRMIQR LRAEIENVKK QNANLQTAIA EAEQRGEMAL KDANAKLQDL QTALQKAKDD LARLLRDYQE LMNVKLALDV EIATYRKLLE GEECRMSGEC QSAVCISVVS NVTSTSGSSG SSRGVFGGVS GSGSGGYKGG SSSSSSSGYG VSGGSGSGYG GVSSGSTGGR GSSGSYQSSS SGSRLGGAGS ISVSHSGMGS SSGSIQTSGG SGYKSGGGGS TSIRFSQTTS SSQHSSTK. It is sometimes possible for the material contained within the vial of "Keratin, type II cytoskeletal 2 oral (KRT76), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
