Keratin, type I cytoskeletal 40 (Krt40) Recombinant Protein | Krt40 recombinant protein
Recombinant Mouse Keratin, type I cytoskeletal 40 (Krt40)
Gene Names
Krt40; K40; CK-40
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Keratin; type I cytoskeletal 40 (Krt40); Recombinant Mouse Keratin; Krt40 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-439, full length protein
Sequence
MASDGSPSCCSSEPCAGASGCATASFCPTNTTCLPNTCSTSRCQTPSFLCRASLPACCLSPCYLAGGCNSPCLVGSCAWCEEGSFNSNEKETMQFLNDRLASYLERVRSLEENNAELECRIREQCEPNAPLVCPDYQRYFDTIEELQQKILCTKAENSRLAVQVDNCKLAADDFRSKYESELSLRQLVENDITGLRGILGELTLCKSDLEAHVESMKDDLICLKKGHEEEVNLLREQLGDRLSVELDTAPTVDLNKVLDEMRCQYERVLANNRRDAEEWFAAQTEELNQQQKSSAEQLEGCQTEMLELKRKANTLEIELQAQQTLTESLECTVAETEAQYSTQLAQMQCLIDSVEHQLAEIRCDLERQNQEYQVLLDTKARLECEINTYRGLLEKEDSRLPCNPGSGAPMPNSTCEPCSNSMCEPCSAYVICTVENCCA
Sequence Length
439
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Krt40 recombinant protein
This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,928 Da
NCBI Official Full Name
keratin, type I cytoskeletal 40 isoform 1
NCBI Official Synonym Full Names
keratin 40
NCBI Official Symbol
Krt40
NCBI Official Synonym Symbols
K40; CK-40
NCBI Protein Information
keratin, type I cytoskeletal 40
UniProt Protein Name
Keratin, type I cytoskeletal 40
Protein Family
UniProt Gene Name
Krt40
UniProt Synonym Gene Names
Ka36; CK-40; K40
Uniprot Description
May play a role in late hair differentiation.
Similar Products
Product Notes
The Krt40 krt40 (Catalog #AAA1482890) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-439, full length protein. The amino acid sequence is listed below: MASDGSPSCC SSEPCAGASG CATASFCPTN TTCLPNTCST SRCQTPSFLC RASLPACCLS PCYLAGGCNS PCLVGSCAWC EEGSFNSNEK ETMQFLNDRL ASYLERVRSL EENNAELECR IREQCEPNAP LVCPDYQRYF DTIEELQQKI LCTKAENSRL AVQVDNCKLA ADDFRSKYES ELSLRQLVEN DITGLRGILG ELTLCKSDLE AHVESMKDDL ICLKKGHEEE VNLLREQLGD RLSVELDTAP TVDLNKVLDE MRCQYERVLA NNRRDAEEWF AAQTEELNQQ QKSSAEQLEG CQTEMLELKR KANTLEIELQ AQQTLTESLE CTVAETEAQY STQLAQMQCL IDSVEHQLAE IRCDLERQNQ EYQVLLDTKA RLECEINTYR GLLEKEDSRL PCNPGSGAPM PNSTCEPCSN SMCEPCSAYV ICTVENCCA. It is sometimes possible for the material contained within the vial of "Keratin, type I cytoskeletal 40 (Krt40), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
