Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Keratin 23 (KRT23) Recombinant Protein | KRT23 recombinant protein

Recombinant Keratin 23 (KRT23)

Gene Names
KRT23; K23; CK23; HAIK1
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Keratin 23 (KRT23); Recombinant Keratin 23 (KRT23); KRT23 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-DMRQEYEL IIKKKHRDLD TWYKEQSAAM SQEAASPATV QSRQGDIHEL KRTFQALEID LQTQYSTKSA LENMLSETQS RYSCKLQDMQ EIISHYEEEL TQLRHELERQ NNEYQVLLGI KTHLEKEITT YRRLLEGESE GT
Sequence Length
422
Applicable Applications for KRT23 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Homo sapiens (Human)
Expression System
Prokaryotic expression
Residues
Asp243~Thr382 (Accession # Q9C075) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22.3kDa
NCBI Official Full Name
keratin, type I cytoskeletal 23 isoform 1
NCBI Official Synonym Full Names
keratin 23 (histone deacetylase inducible)
NCBI Official Symbol
KRT23
NCBI Official Synonym Symbols
K23; CK23; HAIK1
NCBI Protein Information
keratin, type I cytoskeletal 23; CK-23; keratin-23; cytokeratin 23; cytokeratin-23; histone deacetylase inducible keratin 23; type I intermediate filament cytokeratin; hyperacetylation-inducible type I keratin
UniProt Protein Name
Keratin, type I cytoskeletal 23
Protein Family
UniProt Gene Name
KRT23
UniProt Synonym Gene Names
CK-23; K23
UniProt Entry Name
K1C23_HUMAN

NCBI Description

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

K23: a type I cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. There are two types of cytoskeletal and microfibrillar keratin: type I (acidic; 40-55 kDa) [K9 to K20] and type II (neutral to basic; 56-70 kDa) [K1 to K8]. Both a basic and an acidic keratin are required for filament assembly.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: intermediate filament

Molecular Function: structural molecule activity

Research Articles on KRT23

Similar Products

Product Notes

The KRT23 krt23 (Catalog #AAA2011466) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Keratin 23 (KRT23) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the KRT23 krt23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-DMRQEYE L IIKKKHRDLD TWYKEQSAAM SQEAASPATV QSRQGDIHEL KRTFQALEID LQTQYSTKSA LENMLSETQS RYSCKLQDMQ EIISHYEEEL TQLRHELERQ NNEYQVLLGI KTHLEKEITT YRRLLEGESE GT. It is sometimes possible for the material contained within the vial of "Keratin 23 (KRT23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.