Probable serine hydrolase (kraken) Recombinant Protein | kraken recombinant protein
Recombinant Drosophila melanogaster Probable serine hydrolase (kraken)
Gene Names
kraken; CG3943; DmelCG3943; Kraken
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable serine hydrolase (kraken); Recombinant Drosophila melanogaster Probable serine hydrolase (kraken); kraken recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-331, Full length protein
Sequence
MGQTRVAATTAAQSPAAELSPETNGQTEEPLQLLGEDSWEEFSIAVPWGTVEAKWWGSKERQPIIALHGWQDNCGSFDRLCPLLPADTSILAIDLPGHGKSSHYPMGMQYFIFWDGICLIRRIVRKYNWKNVTLLGHSLGGALTFMYAASFPTEVEKLINIDIAGPTVRGTQRMAEGTGRALDKFLDYETLPESKQPCYSYDEMIKLVLDAYDGSVDEPSVRVLMNRGMRHNPSKNGYLFARDLRLKVSLLGMFTAEQTLAYARQIRCRVLNIRGIPGMKFETPQVYADVIATLRENAAKVVYVEVPGTHHLHLVTPDRVAPHIIRFLKEA
Sequence Length
331
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,094 Da
NCBI Official Full Name
kraken, isoform B
NCBI Official Symbol
kraken
NCBI Official Synonym Symbols
CG3943; DmelCG3943; Kraken
NCBI Protein Information
CG3943 gene product from transcript CG3943-RA
UniProt Protein Name
Probable serine hydrolase
Protein Family
UniProt Gene Name
kraken
Uniprot Description
May have a role in detoxification and digestion during embryogenesis and larval development.
Similar Products
Product Notes
The kraken kraken (Catalog #AAA1223653) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-331, Full length protein. The amino acid sequence is listed below: MGQTRVAATT AAQSPAAELS PETNGQTEEP LQLLGEDSWE EFSIAVPWGT VEAKWWGSKE RQPIIALHGW QDNCGSFDRL CPLLPADTSI LAIDLPGHGK SSHYPMGMQY FIFWDGICLI RRIVRKYNWK NVTLLGHSLG GALTFMYAAS FPTEVEKLIN IDIAGPTVRG TQRMAEGTGR ALDKFLDYET LPESKQPCYS YDEMIKLVLD AYDGSVDEPS VRVLMNRGMR HNPSKNGYLF ARDLRLKVSL LGMFTAEQTL AYARQIRCRV LNIRGIPGMK FETPQVYADV IATLRENAAK VVYVEVPGTH HLHLVTPDRV APHIIRFLKE A. It is sometimes possible for the material contained within the vial of "Probable serine hydrolase (kraken), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
