Kinocilin (KNCN) Recombinant Protein | KNCN recombinant protein
Recombinant Human Kinocilin (KNCN)
Gene Names
KNCN; L5; Kino; RP11-49P4.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Kinocilin (KNCN); Recombinant Human Kinocilin (KNCN); Recombinant Kinocilin (KNCN); Kinocilin; KNCN recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-124
Sequence
MDIPISSRDFRGLQLACVALGLVAGSIIIGISVSKAAAAMGGVFIGAAVLGLLILAYPFLKARFNLDHILPTIGSLRIHPHPGADHGEGRSSTNGNKEGARSSLSTVSRTLEKLKPGTRGAEEC
Sequence Length
124
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,832 Da
NCBI Official Full Name
kinocilin
NCBI Official Synonym Full Names
kinocilin
NCBI Official Symbol
KNCN
NCBI Official Synonym Symbols
L5; Kino; RP11-49P4.2
NCBI Protein Information
kinocilin
UniProt Protein Name
Kinocilin
Protein Family
UniProt Gene Name
KNCN
UniProt Entry Name
KNCN_HUMAN
Uniprot Description
KNCN: May play a role in stabilizing dense microtubular networks or in vesicular trafficking. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 1p33
Cellular Component: cell soma; apical plasma membrane; integral to membrane
Similar Products
Product Notes
The KNCN kncn (Catalog #AAA1007014) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-124. The amino acid sequence is listed below: MDIPISSRDF RGLQLACVAL GLVAGSIIIG ISVSKAAAAM GGVFIGAAVL GLLILAYPFL KARFNLDHIL PTIGSLRIHP HPGADHGEGR SSTNGNKEGA RSSLSTVSRT LEKLKPGTRG AEEC. It is sometimes possible for the material contained within the vial of "Kinocilin (KNCN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
