Histone-lysine N-methyltransferase MLL2 (Mll2) Recombinant Protein | Mll2 recombinant protein
Recombinant Mouse Histone-lysine N-methyltransferase MLL2 (Mll2) , partial
Gene Names
Kmt2d; ALR; Mll2; Mll4; KMT2B; BC032281; BC058659; C430014K11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone-lysine N-methyltransferase MLL2 (Mll2); Recombinant Mouse Histone-lysine N-methyltransferase MLL2 (Mll2); partial; Mll2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
225-324; Partial, include the four Zinc finger regions at the N-terminal.
Sequence
EEARCAVCEGPGQLCDLLFCTSCGHHYHGACLDTALTARKRASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHTFCLKPPMEDLPAHSWKCKTCRLCR
Sequence Length
324
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
600,245 Da
NCBI Official Full Name
Histone-lysine N-methyltransferase 2D
NCBI Official Synonym Full Names
lysine (K)-specific methyltransferase 2D
NCBI Official Symbol
Kmt2d
NCBI Official Synonym Symbols
ALR; Mll2; Mll4; KMT2B; BC032281; BC058659; C430014K11Rik
NCBI Protein Information
histone-lysine N-methyltransferase 2D
UniProt Protein Name
Histone-lysine N-methyltransferase 2D
UniProt Gene Name
Kmt2d
UniProt Synonym Gene Names
Mll2; Mll4; Lysine N-methyltransferase 2D
Uniprot Description
Histone methyltransferase. Methylates 'Lys-4' of histone H3 (H3K4me). H3K4me represents a specific tag for epigenetic transcriptional activation. Acts as a coactivator for estrogen receptor by being recruited by ESR1, thereby activating transcription ().
Research Articles on Mll2
Similar Products
Product Notes
The Mll2 kmt2d (Catalog #AAA1391803) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 225-324; Partial, include the four Zinc finger regions at the N-terminal. The amino acid sequence is listed below: EEARCAVCEG PGQLCDLLFC TSCGHHYHGA CLDTALTARK RASWQCPECK VCQSCRKPGN DSKMLVCETC DKGYHTFCLK PPMEDLPAHS WKCKTCRLCR . It is sometimes possible for the material contained within the vial of "Histone-lysine N-methyltransferase MLL2 (Mll2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
