Histone-lysine N-methyltransferase MLL2 (MLL2) Recombinant Protein | KMT2D recombinant protein
Recombinant Human Histone-lysine N-methyltransferase MLL2 (MLL2) , partial
Gene Names
KMT2D; ALR; KMS; MLL2; MLL4; AAD10; KABUK1; TNRC21; CAGL114
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone-lysine N-methyltransferase MLL2 (MLL2); Recombinant Human Histone-lysine N-methyltransferase MLL2 (MLL2); partial; KMT2D recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1762-1861. partial
Sequence
SSKLEDMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
593,677 Da
NCBI Official Full Name
histone-lysine N-methyltransferase 2D
NCBI Official Synonym Full Names
lysine methyltransferase 2D
NCBI Official Symbol
KMT2D
NCBI Official Synonym Symbols
ALR; KMS; MLL2; MLL4; AAD10; KABUK1; TNRC21; CAGL114
NCBI Protein Information
histone-lysine N-methyltransferase 2D
UniProt Protein Name
Histone-lysine N-methyltransferase 2D
Protein Family
UniProt Gene Name
KMT2D
UniProt Synonym Gene Names
ALR; MLL2; MLL4; Lysine N-methyltransferase 2D
NCBI Description
The protein encoded by this gene is a histone methyltransferase that methylates the Lys-4 position of histone H3. The encoded protein is part of a large protein complex called ASCOM, which has been shown to be a transcriptional regulator of the beta-globin and estrogen receptor genes. Mutations in this gene have been shown to be a cause of Kabuki syndrome. [provided by RefSeq, Oct 2010]
Uniprot Description
Histone methyltransferase. Methylates 'Lys-4' of histone H3 (H3K4me). H3K4me represents a specific tag for epigenetic transcriptional activation. Acts as a coactivator for estrogen receptor by being recruited by ESR1, thereby activating transcription.
Research Articles on KMT2D
Similar Products
Product Notes
The KMT2D kmt2d (Catalog #AAA1066459) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1762-1861. partial. The amino acid sequence is listed below: SSKLEDMFPA YLQEAFFGKE LLDLSRKALF AVGVGRPSFG LGTPKAKGDG GSERKELPTS QKGDDGPDIA DEESRGLEGK ADTPGPEDGG VKASPVPSDP E . It is sometimes possible for the material contained within the vial of "Histone-lysine N-methyltransferase MLL2 (MLL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
