Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

NKG2-A/NKG2-B Type II Integral Membrane Recombinant Protein | NKG2-A recombinant protein

Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein

Gene Names
KLRC1; NKG2; NKG2A; CD159A
Purity
>95% by SDS-PAGE.
Synonyms
NKG2-A/NKG2-B Type II Integral Membrane; Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein; NKG2-A/NKG2-B type II integral membrane protein; CD159 antigen-like family member A; NK cellreceptor A; NKG2-A/B-activating NK receptor; CD159a; KLRC1; NKG2A; NKG2-A recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
RHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
Sequence Length
233
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
8xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for NKG2-A recombinant protein
Description: Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg100-Leu233) of human NKG2-A/NKG2-B Type II Integral Membrane Protein (Accession #P26715) fused with an 8xHis tag at the N-terminus.

Background: NKG2-A/NKG2-B Type II Integral Membrane Protein contains 1 C-type lectin domain and belongs to the killercell lectin-like receptor family. The killer cell lectin-like receptor family is a group of transmembrane proteinspreferentially expressed in NK cells. Members of this proteins is characterized by the type II membraneorientation and the presence of a C-type lectin domain. NKG2 is expressed only in NK-cells, but not in T-cells orB-cells. It has been shown that NKG2 represents a family of related cDNA clones, designated NKG2A, NKG2B,NKG2C, and NKG2D, which encode type 2 integral membrane proteins (extracellular C-terminus) containing aC-type lectin domain. NKG2 plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NKcells and some cytotoxic T-cells. NKG2A and NKG2B have been given the designation CD159a in thenomenclature of CD antigens.
Product Categories/Family for NKG2-A recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
NKG2-A/NKG2-B type II integral membrane protein isoform NKG2-A
NCBI Official Synonym Full Names
killer cell lectin like receptor C1
NCBI Official Symbol
KLRC1
NCBI Official Synonym Symbols
NKG2; NKG2A; CD159A
NCBI Protein Information
NKG2-A/NKG2-B type II integral membrane protein
UniProt Protein Name
NKG2-A/NKG2-B type II integral membrane protein
UniProt Gene Name
KLRC1
UniProt Synonym Gene Names
NKG2A
UniProt Entry Name
NKG2A_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jan 2015]

Uniprot Description

NKG2A: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: protein binding; transmembrane receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction

Research Articles on NKG2-A

Similar Products

Product Notes

The NKG2-A klrc1 (Catalog #AAA9140003) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RHNNSSLNTR TQKARHCGHC PEEWITYSNS CYYIGKERRT WEESLLACTS KNSSLLSIDN EEEMKFLSII SPSSWIGVFR NSSHHPWVTM NGLAFKHEIK DSDNAELNCA VLQVNRLKSA QCGSSIIYHC KHKL. It is sometimes possible for the material contained within the vial of "NKG2-A/NKG2-B Type II Integral Membrane, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.