SDS-Page
Prostate-specific antigen Recombinant Protein | KLK3 recombinant protein
Recombinant Human Prostate-specific antigen
Gene Names
KLK3; APS; PSA; hK3; KLK2A1
Applications
Calibrator; Standard
Purity
90% ± 5% by SDS-PAGE
Synonyms
Prostate-specific antigen; Recombinant Human Prostate-specific antigen; Gamma-seminoprotein; Seminin; Kallikrein-3; P-30 antigen; Semenogelase; KLK3 recombinant protein
Purity/Purification
90% ± 5% by SDS-PAGE
Form/Format
Liquid, dissolved in 20 mM Tris-HCl, 500mM NaCL, pH 8.0,50% glycerol
Sequence Positions
28-261
Sequence
GWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Sequence Length
238
Applicable Applications for KLK3 recombinant protein
Calibrator; Standard
Source
Recombination
Product Note
Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
Preparation and Storage
Aliquot and store at < = -20 degree C. Avoid repeated freeze/thaw cycles. -20 degree C for 18 months.
SDS-Page
SDS-Page
Related Product Information for KLK3 recombinant protein
Hydrolyzes senogelin-1 thus leading to the liquefaction of the sinal coagulum.
Product Categories/Family for KLK3 recombinant protein
References
Molecular cloning of human prostate specific antigen cDNA.Lundwall A., Lilja H.FEBS Lett. 214:317-322(1987)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29.9kD
NCBI Official Full Name
prostate-specific antigen isoform 3 preproprotein
NCBI Official Synonym Full Names
kallikrein related peptidase 3
NCBI Official Symbol
KLK3
NCBI Official Synonym Symbols
APS; PSA; hK3; KLK2A1
NCBI Protein Information
prostate-specific antigen
UniProt Protein Name
Prostate-specific antigen
Protein Family
UniProt Gene Name
KLK3
UniProt Synonym Gene Names
APS; PSA; Seminin
UniProt Entry Name
KLK3_HUMAN
Similar Products
Product Notes
The KLK3 klk3 (Catalog #AAA1265342) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-261. AAA Biotech's Prostate-specific antigen can be used in a range of immunoassay formats including, but not limited to, Calibrator; Standard. Researchers should empirically determine the suitability of the KLK3 klk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GWECEKHSQP WQVLVASRGR AVCGGVLVHP QWVLTAAHCI RNKSVILLGR HSLFHPEDTG QVFQVSHSFP HPLYDMSLLK NRFLRPGDDS SHDLMLLRLS EPAELTDAVK VMDLPTQEPA LGTTCYASGW GSIEPEEFLT PKKLQCVDLH VISNDVCAQV HPQKVTKFML CAGRWTGGKS TCSGDSGGPL VCNGVLQGIT SWGSEPCALP ERPSLYTKVV HYRKWIKDTI VANP. It is sometimes possible for the material contained within the vial of "Prostate-specific antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
