Krueppel-like factor 17 (KLF17) Recombinant Protein | KLF17 recombinant protein
Recombinant Human Krueppel-like factor 17 (KLF17)
Gene Names
KLF17; ZNF393; Zfp393
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Krueppel-like factor 17 (KLF17); Recombinant Human Krueppel-like factor 17 (KLF17); KLF17 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-389, Full length protein
Sequence
MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQHFPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPNGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP
Sequence Length
389
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,577 Da
NCBI Official Full Name
Krueppel-like factor 17
NCBI Official Synonym Full Names
Kruppel like factor 17
NCBI Official Symbol
KLF17
NCBI Official Synonym Symbols
ZNF393; Zfp393
NCBI Protein Information
Krueppel-like factor 17
UniProt Protein Name
Krueppel-like factor 17
Protein Family
UniProt Gene Name
KLF17
UniProt Synonym Gene Names
ZNF393
Uniprot Description
Transcription repressor that binds to the promoter of target genes and prevents their expression. Acts as a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer. Specifically binds the 5'-CACCC-3' sequence in the promoter of ID1, a key metastasis regulator in breast cancer, and repress its expression. May be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development ().
Research Articles on KLF17
Similar Products
Product Notes
The KLF17 klf17 (Catalog #AAA1363671) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-389, Full length protein. The amino acid sequence is listed below: MYGRPQAEME QEAGELSRWQ AAHQAAQDNE NSAPILNMSS SSGSSGVHTS WNQGLPSIQH FPHSAEMLGS PLVSVEAPGQ NVNEGGPQFS MPLPERGMSY CPQATLTPSR MIYCQRMSPP QQEMTIFSGP QLMPVGEPNI PRVARPFGGN LRMPPNGLPV SASTGIPIMS HTGNPPVPYP GLSTVPSDET LLGPTVPSTE AQAVLPSMAQ MLPPQDAHDL GMPPAESQSL LVLGSQDSLV SQPDSQEGPF LPEQPGPAPQ TVEKNSRPQE GTGRRGSSEA RPYCCNYENC GKAYTKRSHL VSHQRKHTGE RPYSCNWESC SWSFFRSDEL RRHMRVHTRY RPYKCDQCSR EFMRSDHLKQ HQKTHRPGPS DPQANNNNGE QDSPPAAGP. It is sometimes possible for the material contained within the vial of "Krueppel-like factor 17 (KLF17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
