Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Krueppel-like factor 10 (KLF10) Recombinant Protein | KLF10 recombinant protein

Recombinant Human Krueppel-like factor 10 (KLF10)

Gene Names
KLF10; EGRA; TIEG; TIEG1; EGR-alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Krueppel-like factor 10 (KLF10); Recombinant Human Krueppel-like factor 10 (KLF10); KLF10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-480, Full length protein
Sequence
MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ
Sequence Length
480
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,702 Da
NCBI Official Full Name
Krueppel-like factor 10 isoform b
NCBI Official Synonym Full Names
Kruppel like factor 10
NCBI Official Symbol
KLF10
NCBI Official Synonym Symbols
EGRA; TIEG; TIEG1; EGR-alpha
NCBI Protein Information
Krueppel-like factor 10
UniProt Protein Name
Krueppel-like factor 10
Protein Family
UniProt Gene Name
KLF10
UniProt Synonym Gene Names
TIEG; TIEG1; TGFB-inducible early growth response protein 1; TIEG-1

NCBI Description

This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]

Uniprot Description

Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcriptional activity. Regulates the circadian expression of genes involved in lipogenesis, gluconeogenesis, and glycolysis in the liver. Represses the expression of PCK2, a rate-limiting step enzyme of gluconeogenesis (). May play a role in the cell cycle regulation.

Research Articles on KLF10

Similar Products

Product Notes

The KLF10 klf10 (Catalog #AAA1424044) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-480, Full length protein. The amino acid sequence is listed below: MLNFGASLQQ TAEERMEMIS ERPKESMYSW NKTAEKSDFE AVEALMSMSC SWKSDFKKYV ENRPVTPVSD LSEEENLLPG TPDFHTIPAF CLTPPYSPSD FEPSQVSNLM APAPSTVHFK SLSDTAKPHI AAPFKEEEKS PVSAPKLPKA QATSVIRHTA DAQLCNHQTC PMKAASILNY QNNSFRRRTH LNVEAARKNI PCAAVSPNRS KCERNTVADV DEKASAALYD FSVPSSETVI CRSQPAPVSP QQKSVLVSPP AVSAGGVPPM PVICQMVPLP ANNPVVTTVV PSTPPSQPPA VCPPVVFMGT QVPKGAVMFV VPQPVVQSSK PPVVSPNGTR LSPIAPAPGF SPSAAKVTPQ IDSSRIRSHI CSHPGCGKTY FKSSHLKAHT RTHTGEKPFS CSWKGCERRF ARSDELSRHR RTHTGEKKFA CPMCDRRFMR SDHLTKHARR HLSAKKLPNW QMEVSKLNDI ALPPTPAPTQ. It is sometimes possible for the material contained within the vial of "Krueppel-like factor 10 (KLF10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.