CD158j recombinant protein

CD158j Recombinant Protein

Cat. Num. AAA3004056

• Gene Names: KIR2DS2; NKAT5; cl-49; CD158J; CD158b; NKAT-5; 183ActI; KIR-2DS2
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD158j; CD158j Recombinant Protein; CD158j recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 684
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD158j recombinant protein

Background: KIR2DS2, receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

NCBI and Uniprot Product Information

• NCBI GI #: 6912472
• NCBI GeneID: 100132285
• NCBI Accession #: NP_036444
• NCBI GenBank Nucleotide #: NM_012312.4
• UniProt Accession #: P43631; Q14955; Q6H2G9
• Molecular Weight: Predicted: 28, 33, 37 kDa; Observed: 34, 42 kDa
• NCBI Official Full Name: killer cell immunoglobulin-like receptor 2DS2 isoform a
• NCBI Official Synonym Full Names: killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2
• NCBI Official Symbol: KIR2DS2
• NCBI Official Synonym Symbols: NKAT5; cl-49; CD158J; CD158b; NKAT-5; 183ActI; KIR-2DS2
• NCBI Protein Information: killer cell immunoglobulin-like receptor 2DS2
• UniProt Protein Name: Killer cell immunoglobulin-like receptor 2DS2
• UniProt Gene Name: KIR2DS2
• UniProt Synonym Gene Names: CD158J; NKAT5; NKAT-5; p58 NK receptor CL-49
• UniProt Entry Name: KI2S2_HUMAN

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene represents a haplotype-specific family member that encodes a protein with a short cytoplasmic tail. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]

Uniprot Description

KIR2DS2: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Belongs to the immunoglobulin superfamily.

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to membrane; plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: immune response; innate immune response; regulation of immune response; signal transduction