CD158 recombinant protein

CD158 Recombinant Protein

Cat. Num. AAA3003497

• Gene Names: KIR2DL2; NKAT6; p58.2; CD158b; NKAT-6; CD158B1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD158; CD158 Recombinant Protein; CD158 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 684
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD158 recombinant protein

Background: NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory natural killer cell immunoglobulin-like receptor 2DL1, also designated KIR2DL1, CL-42, NKAT1, P58.1 or CD158a long form, is a 348 amino acid type I transmembrane protein. KIR2DL1 can bindhuman leukocyte antigen-C (HLA-C) via both polar and hydrophobic interactions through Met 44 in a binding pocket that coordinates Lys 80 of HLA-C.

NCBI and Uniprot Product Information

• NCBI GI #: 134304833
• NCBI GeneID: 3803
• NCBI Accession #: NP_055034.2
• NCBI GenBank Nucleotide #: NM_014219.2
• UniProt Accession #: P43627; Q14951; C6EVR8
• Molecular Weight: 38,472 Da
• NCBI Official Full Name: killer cell immunoglobulin-like receptor 2DL2
• NCBI Official Synonym Full Names: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2
• NCBI Official Symbol: KIR2DL2
• NCBI Official Synonym Symbols: NKAT6; p58.2; CD158b; NKAT-6; CD158B1
• NCBI Protein Information: killer cell immunoglobulin-like receptor 2DL2; p58 NK receptor CL-43; MHC class I NK cell receptor; CD158 antigen-like family member B1; natural killer-associated transcript 6; p58 natural killer cell receptor clone CL-43
• UniProt Protein Name: Killer cell immunoglobulin-like receptor 2DL2
• UniProt Gene Name: KIR2DL2
• UniProt Synonym Gene Names: CD158B1; NKAT6; NKAT-6
• UniProt Entry Name: KI2L2_HUMAN

Uniprot Description

KIR2DL2: Receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis. Belongs to the immunoglobulin superfamily.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: plasma membrane; integral to membrane

Biological Process: regulation of immune response