Far upstream element-binding protein 2 (Khsrp) Recombinant Protein | Khsrp recombinant protein
Recombinant Mouse Far upstream element-binding protein 2 (Khsrp)
Gene Names
Khsrp; Fbp2; Ksrp; Fubp2; 6330409F21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Far upstream element-binding protein 2 (Khsrp); Recombinant Mouse Far upstream element-binding protein 2 (Khsrp); Khsrp recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-748, Full length protein
Sequence
SDYNTGGPPPGPPPPAGGGGGAAGAGGGPPPGPPGAGDRGGGGPGGGGPGGGGASGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNNTPDFGFGGQKRQLEDGDQPDSKKLASQGDSIGSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRVGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGAPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFVIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPNKAAAAATDPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQASGNCHPPPPPFSFQPPATVHPALVGSAGNPFPCGVCP
Sequence Length
747
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
76,775 Da
NCBI Official Full Name
far upstream element-binding protein 2
NCBI Official Synonym Full Names
KH-type splicing regulatory protein
NCBI Official Symbol
Khsrp
NCBI Official Synonym Symbols
Fbp2; Ksrp; Fubp2; 6330409F21Rik
NCBI Protein Information
far upstream element-binding protein 2
UniProt Protein Name
Far upstream element-binding protein 2
Protein Family
UniProt Gene Name
Khsrp
UniProt Synonym Gene Names
Fubp2; FUSE-binding protein 2; KSRP
Uniprot Description
Binds to the dendritic targeting element and may play a role in mRNA trafficking. Part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. Mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs ().
Research Articles on Khsrp
Similar Products
Product Notes
The Khsrp khsrp (Catalog #AAA1336772) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-748, Full length protein. The amino acid sequence is listed below: SDYNTGGPPP GPPPPAGGGG GAAGAGGGPP PGPPGAGDRG GGGPGGGGPG GGGASGGPSQ PPGGGGPGIR KDAFADAVQR ARQIAAKIGG DAATTVNNNT PDFGFGGQKR QLEDGDQPDS KKLASQGDSI GSQLGPIHPP PRTSMTEEYR VPDGMVGLII GRGGEQINKI QQDSGCKVQI SPDSGGLPER SVSLTGAPES VQKAKMMLDD IVSRGRGGPP GQFHDNANGG QNGTVQEIMI PAGKAGLVIG KGGETIKQLQ ERAGVKMILI QDGSQNTNVD KPLRIIGDPY KVQQACEMVM DILRERDQGG FGDRNEYGSR VGGGIDVPVP RHSVGVVIGR SGEMIKKIQN DAGVRIQFKQ DDGTGPEKIA HIMGPPDRCE HAARIINDLL QSLRSGPPGP PGAPGMPPGG RGRGRGQGNW GPPGGEMTFS IPTHKCGLVI GRGGENVKAI NQQTGAFVEI SRQLPPNGDP NFKLFVIRGS PQQIDHAKQL IEEKIEGPLC PVGPGPGGPG PAGPMGPFNP GPFNQGPPGA PPHAGGPPPH QYPPQGWGNT YPQWQPPAPH DPNKAAAAAT DPNAAWAAYY SHYYQQPPGP VPGPAPAPAA PPAQGEPPQP PPTGQSDYTK AWEEYYKKIG QQPQQPGAPP QQDYTKAWEE YYKKQAQVAT GGGPGAPPGS QPDYSAAWAE YYRQQAAYYG QTPGPGGPQP PPTQQGQQQA SGNCHPPPPP FSFQPPATVH PALVGSAGNP FPCGVCP. It is sometimes possible for the material contained within the vial of "Far upstream element-binding protein 2 (Khsrp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
