Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-activated potassium channel subunit beta-1 (Kcnmb1) Recombinant Protein | Kcnmb1 recombinant protein

Recombinant Rat Calcium-activated potassium channel subunit beta-1 (Kcnmb1), partial

Gene Names
Kcnmb1; BKbeta; BKbeta1; slo-beta; slo-beta-1; k(VCA)beta-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-activated potassium channel subunit beta-1 (Kcnmb1); Recombinant Rat Calcium-activated potassium channel subunit beta-1 (Kcnmb1); partial; Kcnmb1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
40-155
Sequence
PLYQKSVWTQESTCHLVETNIKDQEELEGRKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALVDVKKVRANFYKHHNFYCFSAPQVNETSVVYQRLYGPQ
Sequence Length
191
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,147 Da
NCBI Official Full Name
calcium-activated potassium channel subunit beta-1
NCBI Official Synonym Full Names
potassium calcium-activated channel subfamily M regulatory beta subunit 1
NCBI Official Symbol
Kcnmb1
NCBI Official Synonym Symbols
BKbeta; BKbeta1; slo-beta; slo-beta-1; k(VCA)beta-1
NCBI Protein Information
calcium-activated potassium channel subunit beta-1
UniProt Protein Name
Calcium-activated potassium channel subunit beta-1
UniProt Gene Name
Kcnmb1
UniProt Synonym Gene Names
BKbeta; BKbeta1; Calcium-activated potassium channel subunit beta; Slo-beta

NCBI Description

modulatory subunit of the MaxiK large conductance potassium channel; voltage and calcium-sensitive potassium channel [RGD, Feb 2006]

Uniprot Description

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca2+/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate ().

Research Articles on Kcnmb1

Similar Products

Product Notes

The Kcnmb1 kcnmb1 (Catalog #AAA1060387) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 40-155. The amino acid sequence is listed below: PLYQKSVWTQ ESTCHLVETN IKDQEELEGR KVPQYPCLWV NVSAVGRWAM LYHTEDTRDQ NQQCSYIPRN LDNYQTALVD VKKVRANFYK HHNFYCFSAP QVNETSVVYQ RLYGPQ. It is sometimes possible for the material contained within the vial of "Calcium-activated potassium channel subunit beta-1 (Kcnmb1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.