Calcium-activated potassium channel subunit alpha-1 (KCNMA1) Recombinant Protein | KCNMA1 recombinant protein

Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1) , partial

Cat. Num. AAA7073755

• Gene Names: KCNMA1; SLO; BKTM; SLO1; hSlo; MaxiK; PNKD3; SAKCA; mSLO1; CADEDS; KCa1.1; SLO-ALPHA; bA205K10.1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Calcium-activated potassium channel subunit alpha-1 (KCNMA1); Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1); partial; KCNMA1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 411-560aa; Partial
• Sequence: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
• Sequence Length: 560

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 62388890
• NCBI GeneID: 3778
• NCBI Accession #: NP_001014797.1
• NCBI GenBank Nucleotide #: NM_001014797.2
• UniProt Accession #: Q12791; Q12886; Q12917; Q12921; Q12960; Q13150; Q5JQ23; Q5SQR9; Q96LG8; Q9UBB0; Q9UCX0; F8WA96
• Molecular Weight: 20.0 kDa
• NCBI Official Full Name: calcium-activated potassium channel subunit alpha-1 isoform a
• NCBI Official Synonym Full Names: potassium calcium-activated channel subfamily M alpha 1
• NCBI Official Symbol: KCNMA1
• NCBI Official Synonym Symbols: SLO; BKTM; SLO1; hSlo; MaxiK; PNKD3; SAKCA; mSLO1; CADEDS; KCa1.1; SLO-ALPHA; bA205K10.1
• NCBI Protein Information: calcium-activated potassium channel subunit alpha-1; uncharacterized protein
• UniProt Protein Name: Calcium-activated potassium channel subunit alpha-1
• Protein Family: Calcium-activated potassium channel
• UniProt Gene Name: KCNMA1
• UniProt Synonym Gene Names: KCNMA; SLO; MaxiK; Slo homolog; hSlo

NCBI Description

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).