Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Potassium channel subfamily K member 3 (KCNK3) Recombinant Protein | KCNK3 recombinant protein

Recombinant Human Potassium channel subfamily K member 3 (KCNK3), partial

Gene Names
KCNK3; OAT1; PPH4; TASK; TBAK1; K2p3.1; TASK-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium channel subfamily K member 3 (KCNK3); Recombinant Human Potassium channel subfamily K member 3 (KCNK3); partial; KCNK3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
244-394. Fragment at the C-terminal, provide the last complete cytoplasmic domain.
Sequence
LRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
Sequence Length
394
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,518 Da
NCBI Official Full Name
potassium channel subfamily K member 3
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 3
NCBI Official Symbol
KCNK3
NCBI Official Synonym Symbols
OAT1; PPH4; TASK; TBAK1; K2p3.1; TASK-1
NCBI Protein Information
potassium channel subfamily K member 3
UniProt Protein Name
Potassium channel subfamily K member 3
UniProt Gene Name
KCNK3
UniProt Synonym Gene Names
TASK; TASK1; Two pore K(+) channel KT3.1

NCBI Description

This gene encodes a member of the superfamily of potassium channel proteins that contain two pore-forming P domains. The encoded protein is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.

Research Articles on KCNK3

Similar Products

Product Notes

The KCNK3 kcnk3 (Catalog #AAA7055189) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 244-394. Fragment at the C-terminal, provide the last complete cytoplasmic domain. The amino acid sequence is listed below: LRFMTMNAED EKRDAEHRAL LTRNGQAGGG GGGGSAHTTD TASSTAAAGG GGFRNVYAEV LHFQSMCSCL WYKSREKLQY SIPMIIPRDL STSDTCVEQS HSSPGGGGRY SDTPSRRCLC SGAPRSAISS VSTGLHSLST FRGLMKRRSS V . It is sometimes possible for the material contained within the vial of "Potassium channel subfamily K member 3 (KCNK3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.