Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Potassium channel subfamily K member 18 (KCNK18) Recombinant Protein | KCNK18 recombinant protein

Recombinant Human Potassium channel subfamily K member 18 (KCNK18)

Gene Names
KCNK18; TRIK; MGR13; TRESK; TRESK2; K2p18.1; TRESK-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium channel subfamily K member 18 (KCNK18); Recombinant Human Potassium channel subfamily K member 18 (KCNK18); KCNK18 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-384aa; full length protein
Sequence
MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEK FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKW CPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTL QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQN RLIDIYKNVMLFFAKGKFYHLVKK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KCNK18 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,671 Da
NCBI Official Full Name
potassium channel subfamily K member 18
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 18
NCBI Official Symbol
KCNK18
NCBI Official Synonym Symbols
TRIK; MGR13; TRESK; TRESK2; K2p18.1; TRESK-2
NCBI Protein Information
potassium channel subfamily K member 18
UniProt Protein Name
Potassium channel subfamily K member 18
UniProt Gene Name
KCNK18
UniProt Synonym Gene Names
TRESK; TRIK
UniProt Entry Name
KCNKI_HUMAN

NCBI Description

Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes a member of the superfamily of potassium channel proteins containing two pore-forming P domains and the encoded protein functions as an outward rectifying potassium channel. A mutation in this gene has been found to be associated with migraine with aura.[provided by RefSeq, Jan 2011]

Uniprot Description

KCNK18: Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. May function as background potassium channel that sets the resting membrane potential. Channel activity is directly activated by calcium signal. Activated by the G(q)-protein coupled receptor pathway. The calcium signal robustly activates the channel via calcineurin, whereas the anchoring of 14-3-3/YWHAH interferes with the return of the current to the resting state after activation. Inhibited also by arachidonic acid and other naturally occurring unsaturated free fatty acids. Channel activity is also enhanced by volatile anesthetics, such as isoflurane. Appears to be the primary target of hydroxy-alpha-sanshool, an ingredient of Schezuan pepper. May be involved in the somatosensory function with special respect to pain sensation. Interacts with calcineurin. Interacts with YWHAH, in a phosphorylation-dependent manner. Expressed specifically in dorsal root ganglion and trigeminal ganglion neurons. Detected at low levels in spinal cord. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.

Protein type: Membrane protein, integral; Channel, potassium; Channel, ligand-gated; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 10q25.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: calcium-activated potassium channel activity; outward rectifier potassium channel activity; potassium channel activity; potassium ion leak channel activity

Biological Process: potassium ion transport; stabilization of membrane potential

Disease: Migraine, With Or Without Aura, Susceptibility To, 13

Research Articles on KCNK18

Similar Products

Product Notes

The KCNK18 kcnk18 (Catalog #AAA7017739) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-384aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCNK18 kcnk18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEVSGHPQAR RCCPEALGKL FPGLCFLCFL VTYALVGAVV FSAIEDGQVL VAADDGEFEK FLEELCRILN CSETVVEDRK QDLQGHLQKV KPQWFNRTTH WSFLSSLFFC CTVFSTVGYG YIYPVTRLGK YLCMLYALFG IPLMFLVLTD TGDILATILS TSYNRFRKFP FFTRPLLSKW CPKSLFKKKP DPKPADEAVP QIIISAEELP GPKLGTCPSR PSCSMELFER SHALEKQNTL QLPPQAMERS NSCPELVLGR LSYSIISNLD EVGQQVERLD IPLPIIALIV FAYISCAAAI LPFWETQLDF ENAFYFCFVT LTTIGFGDTV LEHPNFFLFF SIYIIVGMEI VFIAFKLVQN RLIDIYKNVM LFFAKGKFYH LVKK. It is sometimes possible for the material contained within the vial of "Potassium channel subfamily K member 18 (KCNK18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.